dbPTM

GD_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GD_DROME
UniProt AC	O62589
Protein Name	Serine protease gd
Gene Name	gd
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	531
Subcellular Localization	Secreted .
Protein Description	Component of the extracellular signaling pathway that establishes the dorsal-ventral pathway of the embryo. [PubMed: 9618496]
Protein Sequence	MRLHLAAILILCIEHVTKAVAQGMPISPCPKVFQYRFDGSEWFGLMAVRSPDGHQPLHIRVTLSMRGKPTTYTQNYLGEIELLTRGKFTHNAPVLYKIRFPKHHFPPKLLLMSANNHVICFGSGEHSIFMTQIQLEHIRKLSFIPDKKSSLLLDPEEEEVRKTDDKPPSTPHIQFKKKPFAQAPKEICGRIDRDLDFHLSQRTESLHVAIGEPKSSDGITSPVFVDDDEDDVLEHQFVDESEAEAIESDSADSLPSITRGSWPWLAAIYVNNLTSLDFQCGGSLVSARVVISSAHCFKLFNKRYTSNEVLVFLGRHNLKNWNEEGSLAAPVDGIYIHPDFNSQLSSYDADIAVIILKDEVRFNTFIRPACLWSGSSKTEYIVGERGIVIGWSFDRTNRTRDQKLSSELPGKKSTDASAPKVVKAPIVGNAECFRANAHFRSLSSNRTFCAGIQAEERDTHQSGASIYTGISGAGLFIRRNNRWMLRGTVSAALPAVETPDAESSHKLCCKNQYIIYADVAKFLDWITAFVI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
272	N-linked_Glycosylation	LAAIYVNNLTSLDFQ EEEEEECCCCCCCEE	29.16	-
397	N-linked_Glycosylation	GWSFDRTNRTRDQKL EEEECCCCCCCCHHH	40.92	-
445	N-linked_Glycosylation	HFRSLSSNRTFCAGI HHHHCCCCCEEEEEE	2.13	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GD_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GD_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GD_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SNAK_DROME	snk	genetic	11606540
GD_DROME	gd	physical	11350927
SNAK_DROME	snk	physical	11350927

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GD_DROME

Related Literatures of Post-Translational Modification