GDU5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GDU5_ARATH
• UniProt AC: Q3E965
• Protein Name: Protein GLUTAMINE DUMPER 5
• Gene Name: GDU5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 131
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Description: Probable subunit of an amino acid transporter involved in the regulation of the amino acid metabolism. Stimulates amino acid export by activating nonselective amino acid facilitators..
• Protein Sequence: MRQFPSIRGNINEKMMTTMVESQTRSPWRTPVPYLFGGLAAMLGLIAFALLLLACSYWRLSRQTEDEEKQTESGEKVVAKAFEEKILVIMAGQNNPTFLATPVAAKICLDCVNMEKKEGQNGESKVTEENH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of GDU5_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GDU5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GDU5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GDU5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LOFG2_ARATH	AT3G09770	physical	22291198
LUL1_ARATH	AT5G03200	physical	22291198
CNIH1_ARATH	AT3G12180	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.