UniProt ID | GDU5_ARATH | |
---|---|---|
UniProt AC | Q3E965 | |
Protein Name | Protein GLUTAMINE DUMPER 5 | |
Gene Name | GDU5 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 131 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | Probable subunit of an amino acid transporter involved in the regulation of the amino acid metabolism. Stimulates amino acid export by activating nonselective amino acid facilitators.. | |
Protein Sequence | MRQFPSIRGNINEKMMTTMVESQTRSPWRTPVPYLFGGLAAMLGLIAFALLLLACSYWRLSRQTEDEEKQTESGEKVVAKAFEEKILVIMAGQNNPTFLATPVAAKICLDCVNMEKKEGQNGESKVTEENH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of GDU5_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GDU5_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GDU5_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GDU5_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LOFG2_ARATH | AT3G09770 | physical | 22291198 | |
LUL1_ARATH | AT5G03200 | physical | 22291198 | |
CNIH1_ARATH | AT3G12180 | physical | 24833385 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...