GDU1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GDU1_ARATH
• UniProt AC: O81775
• Protein Name: Protein GLUTAMINE DUMPER 1
• Gene Name: GDU1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 158
• Subcellular Localization: Cell membrane ; Single-pass membrane protein .
• Protein Description: Probable subunit of an amino acid transporter involved in the regulation of the amino acid metabolism. Stimulates amino acid export by activating nonselective amino acid facilitators. Required the interaction with the RING-type E3 ubiquitin-protein ligase LOG2 to fulfill its function. Plays a role in the Gln export at hydathodes, at xylem parenchyma into xylem sap and from mesophyll into leaf apoplasm. Acts upstream genes involved in the salicylic acid (SA) pathway and in the geminivirus-host interaction..
• Protein Sequence: MRPLSVQSKFEDVATSTSVNHHGVTPQSPWHSPVPYLFGGLAAMLGLIAFALLILACSYWRLSSSGEEDGQNVDEEKESRSGDKAANGAYEEKFLVIMAGEDLPRYLATPAMKKCTCGGHEGKMVISQEESVAKEEEKMREGEEEKVKDTGETTTTSH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of GDU1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GDU1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GDU1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GDU1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LOFG2_ARATH	AT3G09770	physical	22291198
LUL1_ARATH	AT5G03200	physical	22291198
UBQ3_ARATH	UBQ3	physical	24036454

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.