UniProt ID | GDF8_HUMAN | |
---|---|---|
UniProt AC | O14793 | |
Protein Name | Growth/differentiation factor 8 | |
Gene Name | MSTN | |
Organism | Homo sapiens (Human). | |
Sequence Length | 375 | |
Subcellular Localization | Secreted . | |
Protein Description | Acts specifically as a negative regulator of skeletal muscle growth.. | |
Protein Sequence | MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
62 | Phosphorylation | AIKIQILSKLRLETA HHHHHHHHHCCCCCC | 31.13 | 24719451 | |
71 | N-linked_Glycosylation | LRLETAPNISKDVIR CCCCCCCCCCHHHHH | 49.02 | UniProtKB CARBOHYD | |
304 | Phosphorylation | WIIAPKRYKANYCSG EEECCCCEECCCCCC | 22.15 | - | |
308 | Phosphorylation | PKRYKANYCSGECEF CCCEECCCCCCEEEE | 7.89 | - | |
310 | Phosphorylation | RYKANYCSGECEFVF CEECCCCCCEEEEEE | 27.54 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GDF8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GDF8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GDF8_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FSTL3_HUMAN | FSTL3 | physical | 12194980 | |
A4_HUMAN | APP | physical | 21832049 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...