GBG2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GBG2_MOUSE
• UniProt AC: P63213
• Protein Name: Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
• Gene Name: Gng2
• Organism: Mus musculus (Mouse).
• Sequence Length: 71
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction..
• Protein Sequence: MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MASNNTASI ------CCCCCHHHH	22.44	-
3	Phosphorylation	-----MASNNTASIA -----CCCCCHHHHH	29.34	23375375
6	Phosphorylation	--MASNNTASIAQAR --CCCCCHHHHHHHH	26.49	26824392
8	Phosphorylation	MASNNTASIAQARKL CCCCCHHHHHHHHHH	19.20	23527152
14	Ubiquitination	ASIAQARKLVEQLKM HHHHHHHHHHHHHHH	60.96	22790023
20	Ubiquitination	RKLVEQLKMEANIDR HHHHHHHHHHHCCCH	34.10	22790023
32	Ubiquitination	IDRIKVSKAAADLMA CCHHHHHHHHHHHHH	45.06	22790023
46	Ubiquitination	AYCEAHAKEDPLLTP HHHHHHCCCCCCCCC	53.43	22790023
52	Phosphorylation	AKEDPLLTPVPASEN CCCCCCCCCCCCCCC	29.89	25521595
57	Phosphorylation	LLTPVPASENPFREK CCCCCCCCCCCCCCC	31.66	24925903
64	Ubiquitination	SENPFREKKFFCAIL CCCCCCCCCCEEEEC	51.10	22790023
68	Methylation	FREKKFFCAIL---- CCCCCCEEEEC----	2.31	-
68	Geranylgeranylation	FREKKFFCAIL---- CCCCCCEEEEC----	2.31	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GBG2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GBG2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GBG2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GNAO_MOUSE	Gnao1	physical	8550614

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Qualitative and quantitative analyses of protein phosphorylation innaive and stimulated mouse synaptosomal preparations.";
Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F.,Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D.,Gerrits B., Panse C., Schlapbach R., Mansuy I.M.;
Mol. Cell. Proteomics 6:283-293(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-52, AND MASSSPECTROMETRY.
PubMed: 17114649