GBF2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GBF2_ARATH
• UniProt AC: P42775
• Protein Name: G-box-binding factor 2
• Gene Name: GBF2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 360
• Subcellular Localization: Nucleus .
• Protein Description: Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. GBF2 is found to bind asymmetrically to the G-box..
• Protein Sequence: MGSNEEGNPTNNSDKPSQAAAPEQSNVHVYHHDWAAMQAYYGPRVGIPQYYNSNLAPGHAPPPYMWASPSPMMAPYGAPYPPFCPPGGVYAHPGVQMGSQPQGPVSQSASGVTTPLTIDAPANSAGNSDHGFMKKLKEFDGLAMSISNNKVGSAEHSSSEHRSSQSSENDGSSNGSDGNTTGGEQSRRKRRQQRSPSTGERPSSQNSLPLRGENEKPDVTMGTPVMPTAMSFQNSAGMNGVPQPWNEKEVKREKRKQSNRESARRSRLRKQAETEQLSVKVDALVAENMSLRSKLGQLNNESEKLRLENEAILDQLKAQATGKTENLISRVDKNNSVSGSKTVQHQLLNASPITDPVAAS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
145	Phosphorylation	EFDGLAMSISNNKVG HHCCEEEEECCCCCC	19.77	30407730
147	Phosphorylation	DGLAMSISNNKVGSA CCEEEEECCCCCCCC	27.35	30407730
157	Phosphorylation	KVGSAEHSSSEHRSS CCCCCCCCCCCCCCC	27.37	19880383
195	Phosphorylation	RKRRQQRSPSTGERP HHHHHHCCCCCCCCC	20.90	19880383
197	Phosphorylation	RRQQRSPSTGERPSS HHHHCCCCCCCCCCC	50.74	29654922
198	Phosphorylation	RQQRSPSTGERPSSQ HHHCCCCCCCCCCCC	46.58	23660473
203	Phosphorylation	PSTGERPSSQNSLPL CCCCCCCCCCCCCCC	51.26	23660473
204	Phosphorylation	STGERPSSQNSLPLR CCCCCCCCCCCCCCC	35.74	23660473
207	Phosphorylation	ERPSSQNSLPLRGEN CCCCCCCCCCCCCCC	24.59	23660473
321	Phosphorylation	DQLKAQATGKTENLI HHHHHHHHCCHHHHH	27.42	24894044
351	Phosphorylation	QHQLLNASPITDPVA HHHHHCCCCCCCCCC	18.76	19880383
354	Phosphorylation	LLNASPITDPVAAS- HHCCCCCCCCCCCC-	37.32	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GBF2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GBF2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GBF2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HY5_ARATH	HY5	physical	19802365

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.