UniProt ID | GAGE5_HUMAN | |
---|---|---|
UniProt AC | Q13069 | |
Protein Name | G antigen 5 | |
Gene Name | GAGE5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 117 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MSWRGRSTYYWPRP -CCCCCCCCCCCCCC | 24.48 | 21945579 | |
8 | Phosphorylation | MSWRGRSTYYWPRPR CCCCCCCCCCCCCCC | 21.19 | 21945579 | |
9 | Phosphorylation | SWRGRSTYYWPRPRR CCCCCCCCCCCCCCC | 12.55 | 21945579 | |
10 | Phosphorylation | WRGRSTYYWPRPRRY CCCCCCCCCCCCCCC | 14.71 | 21945579 | |
13 | Methylation | RSTYYWPRPRRYVQP CCCCCCCCCCCCCCC | 24.18 | - | |
15 | Methylation | TYYWPRPRRYVQPPE CCCCCCCCCCCCCCH | 43.79 | - | |
17 | Phosphorylation | YWPRPRRYVQPPEVI CCCCCCCCCCCCHHH | 12.52 | 22210691 | |
33 | Phosphorylation | PMRPEQFSDEVEPAT CCCHHHHCCCCCCCC | 32.34 | 22210691 | |
40 | Phosphorylation | SDEVEPATPEEGEPA CCCCCCCCCCCCCCC | 41.78 | 29507054 | |
48 | Phosphorylation | PEEGEPATQRQDPAA CCCCCCCCCCCCHHH | 34.69 | 25850435 | |
115 | Phosphorylation | PEEGEKQSQC----- HHHCCCCCCC----- | 44.58 | 30576142 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GAGE5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GAGE5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GAGE5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GMCL1_HUMAN | GMCL1 | physical | 25416956 | |
GMCL1_HUMAN | GMCL1 | physical | 21516116 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...