dbPTM

FYV5_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FYV5_YEAST
UniProt AC	P25585
Protein Name	Protein FYV5
Gene Name	FYV5
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	152
Subcellular Localization	Cell membrane Multi-pass membrane protein . Secreted, cell wall.
Protein Description	Involved in maintaining an adequate ionic strength homeostasis of the cellular aqueous environment, necessary for normal growth rate. Required for survival upon exposure to K1 killer toxin and hence plays a role in cell wall glucan synthesis. Required for dithiothreitol (DTT) resistance. Involved in cell cycle progression..
Protein Sequence	MQYHSALYVYIYVTFTTIPYKEKPDIISICFSMLSFVFDFSVRICSRTLESFSWSLISSSAFKVVSAFSLAGSCVLASRSSVGIIVSLLLFNFSTCNFVLFLSAVLIDLFFCTFLPTPTFLPTPFFFMLHLPIFSLLNALELLYLIIAGLHI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MQYHSALYVY -----CCCCCEEEEE	9.10	29688323
5	Phosphorylation	---MQYHSALYVYIY ---CCCCCEEEEEEE	18.29	29688323
8	Phosphorylation	MQYHSALYVYIYVTF CCCCCEEEEEEEEEE	7.30	29688323
10	Phosphorylation	YHSALYVYIYVTFTT CCCEEEEEEEEEEEC	3.50	28132839
12	Phosphorylation	SALYVYIYVTFTTIP CEEEEEEEEEEECCC	3.92	28132839
14	Phosphorylation	LYVYIYVTFTTIPYK EEEEEEEEEECCCCC	9.78	29688323
16	Phosphorylation	VYIYVTFTTIPYKEK EEEEEEEECCCCCCC	17.91	29688323
17	Phosphorylation	YIYVTFTTIPYKEKP EEEEEEECCCCCCCC	18.76	29688323
20	Phosphorylation	VTFTTIPYKEKPDII EEEECCCCCCCCCHH	28.12	28132839

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FYV5_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FYV5_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FYV5_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SNF1_YEAST	SNF1	physical	25452167

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FYV5_YEAST

Related Literatures of Post-Translational Modification