FXYD7_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FXYD7_HUMAN
• UniProt AC: P58549
• Protein Name: FXYD domain-containing ion transport regulator 7
• Gene Name: FXYD7
• Organism: Homo sapiens (Human).
• Sequence Length: 80
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
64	Ubiquitination	RSESPTCKSCKSELP CCCCCCCHHHHHCCC	62.46	32142685
65	Phosphorylation	SESPTCKSCKSELPS CCCCCCHHHHHCCCC	28.99	24076635
67	Ubiquitination	SPTCKSCKSELPSSA CCCCHHHHHCCCCCC	54.80	32142685
68	Phosphorylation	PTCKSCKSELPSSAP CCCHHHHHCCCCCCC	49.01	24076635
72	Phosphorylation	SCKSELPSSAPGGGG HHHHCCCCCCCCCCC	52.32	24719451
73	Phosphorylation	CKSELPSSAPGGGGV HHHCCCCCCCCCCCC	36.22	25332170

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FXYD7_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FXYD7_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FXYD7_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AT1A1_RAT	Atp1a1	physical	12093728
AT1B1_RAT	Atp1b1	physical	12093728

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.