UniProt ID | FXYD7_HUMAN | |
---|---|---|
UniProt AC | P58549 | |
Protein Name | FXYD domain-containing ion transport regulator 7 | |
Gene Name | FXYD7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 80 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
64 | Ubiquitination | RSESPTCKSCKSELP CCCCCCCHHHHHCCC | 62.46 | 32142685 | |
65 | Phosphorylation | SESPTCKSCKSELPS CCCCCCHHHHHCCCC | 28.99 | 24076635 | |
67 | Ubiquitination | SPTCKSCKSELPSSA CCCCHHHHHCCCCCC | 54.80 | 32142685 | |
68 | Phosphorylation | PTCKSCKSELPSSAP CCCHHHHHCCCCCCC | 49.01 | 24076635 | |
72 | Phosphorylation | SCKSELPSSAPGGGG HHHHCCCCCCCCCCC | 52.32 | 24719451 | |
73 | Phosphorylation | CKSELPSSAPGGGGV HHHCCCCCCCCCCCC | 36.22 | 25332170 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FXYD7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FXYD7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FXYD7_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...