FRI3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FRI3_ARATH
• UniProt AC: Q9LYN2
• Protein Name: Ferritin-3, chloroplastic
• Gene Name: FER3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 259
• Subcellular Localization: Plastid, chloroplast.
• Protein Description: Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation (By similarity)..
• Protein Sequence: MLLKAASTFSLLNIHGEKKDISPLFSSSSSISSPVSSGKSGNLSFPLRASKSSTTTTSTLSGVVFEPFEEVKKEMDLVPSGQQLSLARHLYSPECEAAVNEQINVEYNVSYVYHALYAYFDRDNVALKGLAKFFKESSVEEREHAELLMEYQNKRGGRVKLQPMVLPQSEFDHPEKGDALYAMELALSLEKLVNEKLLNLHSVASKNDDVQLADFIESVFLNEQVEAIKKISEYVSQLRRLGKGHGTWHFDQELLGAAA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of FRI3_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FRI3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FRI3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FRI3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FRI1_ARATH	FER1	physical	24823379
CIPKE_ARATH	SR1	physical	24823379

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.