UniProt ID | FLT3L_HUMAN | |
---|---|---|
UniProt AC | P49771 | |
Protein Name | Fms-related tyrosine kinase 3 ligand | |
Gene Name | FLT3LG | |
Organism | Homo sapiens (Human). | |
Sequence Length | 235 | |
Subcellular Localization |
Isoform 1: Cell membrane Single-pass type I membrane protein. Isoform 2: Secreted. |
|
Protein Description | Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.. | |
Protein Sequence | MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
126 | N-linked_Glycosylation | CLRFVQTNISRLLQE HHHHHHHHHHHHHHH | 17.10 | UniProtKB CARBOHYD | |
142 | Ubiquitination | SEQLVALKPWITRQN HHHHHHHHHHHHHCC | 28.68 | - | |
149 | N-linked_Glycosylation | KPWITRQNFSRCLEL HHHHHHCCHHHHEEE | 33.30 | UniProtKB CARBOHYD | |
170 | Phosphorylation | STLPPPWSPRPLEAT CCCCCCCCCCCCCCC | 19.46 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FLT3L_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FLT3L_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FLT3L_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FLT3L_HUMAN | FLT3LG | physical | 10881197 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...