FLOWR_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FLOWR_DROME
• UniProt AC: Q95T12
• Protein Name: Calcium channel flower {ECO:0000303|PubMed:19737521}
• Gene Name: fwe
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 194
• Subcellular Localization: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane ; Multi-pass membrane protein . Upon fusion of the synaptic vesicle with the presynaptic membrane, protein is present in the periactive zones, where endocytosis is known to occur.
• Protein Description: A calcium channel that regulates synaptic endocytosis and hence couples exo- with endocytosis. Isoform A and isoform B are mainly required in the nervous system and necessary in photoreceptor cells..
• Protein Sequence: MSFAEKITGLLARPNQQDPIGPEQPWYLKYGSRLLGIVAAFFAILFGLWNVFSIITLSVSCLVAGILQMVAGFVVMLLEAPCCFVCFGQVNEIAEKVESKPLYFRAGLYIAMAIPPIILCFGLASLFGSGLIFGTGVVYGMMALGKKASAEDMRAAAQQTFGGNTPAQTNDRAGIVNNAQPFSFTGAVGTDSNV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
165	Phosphorylation	QQTFGGNTPAQTNDR HHHHCCCCCCCCCCC	24.23	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FLOWR_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FLOWR_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FLOWR_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DIAP1_DROME	th	genetic	26287461
FLOWR_DROME	fwe	physical	19737521

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.