FLC_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FLC_ARATH
• UniProt AC: Q9S7Q7
• Protein Name: MADS-box protein FLOWERING LOCUS C
• Gene Name: FLC
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 196
• Subcellular Localization: Nucleus .
• Protein Description: Putative transcription factor that seems to play a central role in the regulation of flowering time in the late-flowering phenotype by interacting with 'FRIGIDA', the autonomous and the vernalization flowering pathways. Inhibits flowering by repressing 'SUPPRESSOR OF OVEREXPRESSION OF CONSTANS 1'..
• Protein Sequence: MGRKKLEIKRIENKSSRQVTFSKRRNGLIEKARQLSVLCDASVALLVVSASGKLYSFSSGDNLVKILDRYGKQHADDLKALDHQSKALNYGSHYELLELVDSKLVGSNVKNVSIDALVQLEEHLETALSVTRAKKTELMLKLVENLKEKEKMLKEENQVLASQMENNHHVGAEAEMEMSPAGQISDNLPVTLPLLN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of FLC_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FLC_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FLC_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FLC_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SVP_ARATH	SVP	physical	18606145
MED25_ARATH	PFT1	physical	25150167

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.