UniProt ID | FLC_ARATH | |
---|---|---|
UniProt AC | Q9S7Q7 | |
Protein Name | MADS-box protein FLOWERING LOCUS C | |
Gene Name | FLC | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 196 | |
Subcellular Localization | Nucleus . | |
Protein Description | Putative transcription factor that seems to play a central role in the regulation of flowering time in the late-flowering phenotype by interacting with 'FRIGIDA', the autonomous and the vernalization flowering pathways. Inhibits flowering by repressing 'SUPPRESSOR OF OVEREXPRESSION OF CONSTANS 1'.. | |
Protein Sequence | MGRKKLEIKRIENKSSRQVTFSKRRNGLIEKARQLSVLCDASVALLVVSASGKLYSFSSGDNLVKILDRYGKQHADDLKALDHQSKALNYGSHYELLELVDSKLVGSNVKNVSIDALVQLEEHLETALSVTRAKKTELMLKLVENLKEKEKMLKEENQVLASQMENNHHVGAEAEMEMSPAGQISDNLPVTLPLLN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of FLC_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FLC_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FLC_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FLC_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SVP_ARATH | SVP | physical | 18606145 | |
MED25_ARATH | PFT1 | physical | 25150167 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...