UniProt ID | FKB1B_MOUSE | |
---|---|---|
UniProt AC | Q9Z2I2 | |
Protein Name | Peptidyl-prolyl cis-trans isomerase FKBP1B | |
Gene Name | Fkbp1b | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 108 | |
Subcellular Localization | Cytoplasm. Sarcoplasmic reticulum. | |
Protein Description | Has the potential to contribute to the immunosuppressive and toxic effects of FK506 and rapamycin. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).. | |
Protein Sequence | MGVEIETISPGDGRTFPKKGQICVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGTAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLSLE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | S-nitrosocysteine | FPKKGQICVVHYTGM CCCCCCEEEEEEECC | 1.69 | - | |
23 | S-nitrosylation | FPKKGQICVVHYTGM CCCCCCEEEEEEECC | 1.69 | 21278135 | |
36 | Ubiquitination | GMLQNGKKFDSSRDR CCEECCCCCCCCCCC | 56.66 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKB1B_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKB1B_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKB1B_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RYR2_MOUSE | Ryr2 | physical | 16481613 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...