| UniProt ID | FKB1B_MOUSE | |
|---|---|---|
| UniProt AC | Q9Z2I2 | |
| Protein Name | Peptidyl-prolyl cis-trans isomerase FKBP1B | |
| Gene Name | Fkbp1b | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 108 | |
| Subcellular Localization | Cytoplasm. Sarcoplasmic reticulum. | |
| Protein Description | Has the potential to contribute to the immunosuppressive and toxic effects of FK506 and rapamycin. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).. | |
| Protein Sequence | MGVEIETISPGDGRTFPKKGQICVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGTAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLSLE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 23 | S-nitrosocysteine | FPKKGQICVVHYTGM CCCCCCEEEEEEECC | 1.69 | - | |
| 23 | S-nitrosylation | FPKKGQICVVHYTGM CCCCCCEEEEEEECC | 1.69 | 21278135 | |
| 36 | Ubiquitination | GMLQNGKKFDSSRDR CCEECCCCCCCCCCC | 56.66 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKB1B_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKB1B_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKB1B_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RYR2_MOUSE | Ryr2 | physical | 16481613 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...