UniProt ID | FIZ1_MOUSE | |
---|---|---|
UniProt AC | Q9WTJ4 | |
Protein Name | Flt3-interacting zinc finger protein 1 | |
Gene Name | Fiz1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 500 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | May be a transcriptional repressor of NRL function in photoreceptors. Does not repress CRX-mediated transactivation (By similarity).. | |
Protein Sequence | MEDSSLPVVPAPIAAPGPAPSATAPRVPFHCSECGKSFRYRSDLRRHFARHTALKPHACPRCGKGFKHSFNLANHLRSHTGERPYRCSACPKGFRDSTGLLHHQVVHTGEKPYCCLVCELRFSSRSSLGRHLKRQHRGTLPSPLQPSPGLPPLSSPCSVCCNVGPCSVCGGGGSSGGEGLEGAGATSWGLAEAAAAAAASLPPFACGACARRFDHGRELAAHWAAHTDVKPFKCPRCERDFNAPALLERHKLTHDLQGSNAPPTQVWASGGGPEVAGEGDASEVGAAPQTWDAGLLLSPTGAGVPKLEALLPGDEGSGNDQAPAAAAEASSEDTLYQCDCGTFFASAPALASHLEAHSGPATYGCGHCGALYAALAALEEHRRASHGEGSGEAAPDGEGNQAAGGPGPGSSSRSKKIFGCSECEKLFRSPRDLERHVLVHTGEKPFPCLECGKFFRHECYLKRHRLLHGTERPFPCHICGKGFITLSNLSRHLKLHRGMD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEDSSLPV -------CCCCCCCC | 13.41 | - | |
108 | Phosphorylation | LHHQVVHTGEKPYCC CCEEEEECCCCCEEE | 35.11 | 23140645 | |
385 | Phosphorylation | LEEHRRASHGEGSGE HHHHHHHHCCCCCCC | 30.16 | - | |
441 | Phosphorylation | ERHVLVHTGEKPFPC HCCEEEECCCCCCCE | 39.29 | 23140645 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FIZ1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FIZ1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FIZ1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FLT3_MOUSE | Flt3 | physical | 10409713 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...