FIS1B_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FIS1B_ARATH
• UniProt AC: Q94CK3
• Protein Name: Mitochondrial fission 1 protein B
• Gene Name: FIS1B
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 167
• Subcellular Localization: Mitochondrion outer membrane; Single-pass membrane protein. Peroxisome membrane ; Single-pass membrane protein .
• Protein Description: Component of the peroxisomal and mitochondrial division machineries. Plays a role in promoting the fission of mitochondria and peroxisomes. In association with PEX11C, PEX11D, PEX11E and DRP3A, is involved in cell cycle-associated constitutive self-replication of preexisting peroxisomes..
• Protein Sequence: MDAAIGKVFDSVSDFFSGAASASADEFPLCDSDIISGCEKELAEAQDEGRKKECIMRLSWALVHSKMPSDIQRGIAMLEALVVNDTSAMKLREKLYLLALGYYRSGDFSRSRDCIERCLEVEPESGQAQALKKAIEDRIVKDGVIGVGIAVTAVGVVAGIAAAILRS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of FIS1B_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FIS1B_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FIS1B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FIS1B_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARC5_ARATH	ARC5	physical	20179140

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.