UniProt ID | FIS1B_ARATH | |
---|---|---|
UniProt AC | Q94CK3 | |
Protein Name | Mitochondrial fission 1 protein B | |
Gene Name | FIS1B | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 167 | |
Subcellular Localization |
Mitochondrion outer membrane Single-pass membrane protein. Peroxisome membrane Single-pass membrane protein . |
|
Protein Description | Component of the peroxisomal and mitochondrial division machineries. Plays a role in promoting the fission of mitochondria and peroxisomes. In association with PEX11C, PEX11D, PEX11E and DRP3A, is involved in cell cycle-associated constitutive self-replication of preexisting peroxisomes.. | |
Protein Sequence | MDAAIGKVFDSVSDFFSGAASASADEFPLCDSDIISGCEKELAEAQDEGRKKECIMRLSWALVHSKMPSDIQRGIAMLEALVVNDTSAMKLREKLYLLALGYYRSGDFSRSRDCIERCLEVEPESGQAQALKKAIEDRIVKDGVIGVGIAVTAVGVVAGIAAAILRS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of FIS1B_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FIS1B_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FIS1B_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FIS1B_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ARC5_ARATH | ARC5 | physical | 20179140 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...