| UniProt ID | FHL3_MOUSE | |
|---|---|---|
| UniProt AC | Q9R059 | |
| Protein Name | Four and a half LIM domains protein 3 | |
| Gene Name | Fhl3 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 289 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MSEAFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNECYCTAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCKTPLAGQQFTSRDDDPYCVACFGELFAPKCSSCKRPITGGSGGGEGAGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSEAFDCAK ------CCCCCHHHC | 37.32 | - | |
| 95 | Phosphorylation | LCNECYCTAFSSQCS CCCCCEEECCHHHCC | 12.31 | - | |
| 98 | Phosphorylation | ECYCTAFSSQCSACG CCEEECCHHHCCCCC | 19.62 | - | |
| 99 | Phosphorylation | CYCTAFSSQCSACGE CEEECCHHHCCCCCC | 28.84 | - | |
| 150 | Glutathionylation | PDKGAHYCVPCYENK CCCCCCEEEECCCCC | 1.66 | 24333276 | |
| 153 | Glutathionylation | GAHYCVPCYENKFAP CCCEEEECCCCCCCH | 3.12 | 24333276 | |
| 157 | Ubiquitination | CVPCYENKFAPRCAR EEECCCCCCCHHHHH | 30.85 | 22790023 | |
| 157 | Ubiquitination | CVPCYENKFAPRCAR EEECCCCCCCHHHHH | 30.85 | 22790023 | |
| 157 | Acetylation | CVPCYENKFAPRCAR EEECCCCCCCHHHHH | 30.85 | 23806337 | |
| 167 | Ubiquitination | PRCARCSKTLTQGGV HHHHHCCCEEEECCC | 51.70 | 22790023 | |
| 167 | Ubiquitination | PRCARCSKTLTQGGV HHHHHCCCEEEECCC | 51.70 | 22790023 | |
| 168 | Phosphorylation | RCARCSKTLTQGGVT HHHHCCCEEEECCCE | 20.81 | 25338131 | |
| 192 | Ubiquitination | CLVCTGCKTPLAGQQ EEEECCCCCCCCCCC | 55.30 | 22790023 | |
| 192 | Ubiquitination | CLVCTGCKTPLAGQQ EEEECCCCCCCCCCC | 55.30 | 22790023 | |
| 193 | Phosphorylation | LVCTGCKTPLAGQQF EEECCCCCCCCCCCC | 27.84 | 28542873 | |
| 229 | Phosphorylation | SSCKRPITGGSGGGE CCCCCCCCCCCCCCC | 37.87 | 22942356 | |
| 232 | Phosphorylation | KRPITGGSGGGEGAG CCCCCCCCCCCCCCC | 35.08 | 28464351 | |
| 244 | Acetylation | GAGLGGGKYVSFEDR CCCCCCCCEEECCCC | 45.84 | 23806337 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FHL3_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FHL3_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FHL3_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CTBP2_MOUSE | Ctbp2 | physical | 16940173 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...