FGF1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FGF1_MOUSE
• UniProt AC: P61148
• Protein Name: Fibroblast growth factor 1
• Gene Name: Fgf1
• Organism: Mus musculus (Mouse).
• Sequence Length: 155
• Subcellular Localization: Secreted. Cytoplasm. Cytoplasm, cell cortex. Cytoplasm, cytosol. Nucleus. Lacks a cleavable signal sequence. Within the cytoplasm, it is transported to the cell membrane and then secreted by a non-classical pathway that requires Cu(2+) ions and S100A
• Protein Description: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV:ITGB3. Its binding to integrin, subsequent ternary complex formation with integrin and FGFR1, and the recruitment of PTPN11 to the complex are essential for FGF1 signaling. Induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2 and AKT1. Can induce angiogenesis..
• Protein Sequence: MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAEGEITTF ------CCCCCCCHH	33.24	-
62	Phosphorylation	QHIQLQLSAESAGEV CCEEEEEEHHCCCEE	19.61	-
65	Phosphorylation	QLQLSAESAGEVYIK EEEEEHHCCCEEEEE	41.09	-
109	Phosphorylation	ERLEENHYNTYTSKK HHHHHHCCCCCCCHH	22.30	25195567
153	Phosphorylation	LFLPLPVSSD----- EEEECCCCCC-----	27.18	21743459
154	Phosphorylation	FLPLPVSSD------ EEECCCCCC------	47.80	21743459

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FGF1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FGF1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FGF1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RS2_HUMAN	RPS2	physical	16263090

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.