UniProt ID | FGF10_HUMAN | |
---|---|---|
UniProt AC | O15520 | |
Protein Name | Fibroblast growth factor 10 | |
Gene Name | FGF10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 208 | |
Subcellular Localization | Secreted . | |
Protein Description | Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.. | |
Protein Sequence | MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
51 | N-linked_Glycosylation | MVSPEATNSSSSSFS CCCCCCCCCCCCCCC | 47.12 | UniProtKB CARBOHYD | |
84 | Phosphorylation | VRWRKLFSFTKYFLK HHHHHHHHEEEEEEE | 42.30 | 24719451 | |
108 | Phosphorylation | TKKENCPYSILEITS CCCCCCCCEEEEEEE | 15.56 | 24248375 | |
114 | Phosphorylation | PYSILEITSVEIGVV CCEEEEEEEEEEEEE | 19.83 | 20036575 | |
115 | Phosphorylation | YSILEITSVEIGVVA CEEEEEEEEEEEEEE | 24.34 | 24248375 | |
161 | Phosphorylation | ERIEENGYNTYASFN HHHHHCCCCCCEEEE | 18.86 | 22817900 | |
164 | Phosphorylation | EENGYNTYASFNWQH HHCCCCCCEEEEEEE | 9.16 | 22817900 | |
196 | N-linked_Glycosylation | GQKTRRKNTSAHFLP CCCCCCCCCCCCCCE | 37.14 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FGF10_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FGF10_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FGF10_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
H11_HUMAN | HIST1H1A | physical | 26186194 | |
RL26L_HUMAN | RPL26L1 | physical | 26186194 | |
SIR1_HUMAN | SIRT1 | physical | 26186194 | |
ITIH2_HUMAN | ITIH2 | physical | 26186194 | |
HBD_HUMAN | HBD | physical | 26186194 | |
H11_HUMAN | HIST1H1A | physical | 28514442 | |
ITIH2_HUMAN | ITIH2 | physical | 28514442 | |
RL26L_HUMAN | RPL26L1 | physical | 28514442 | |
SIR1_HUMAN | SIRT1 | physical | 28514442 |
loading...