FEND_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FEND_DROME
• UniProt AC: Q9GNL3
• Protein Name: Transmembrane protein fend
• Gene Name: fend
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 321
• Subcellular Localization: Membrane ; Single-pass type I membrane protein .
• Protein Description: Involved in the normal targeting of ventral muscle, muscle 12, by motoneurons. May function as an axon guidance molecule involved in neuromuscular specificity..
• Protein Sequence: MFHSLVLMACALAALSVAQGAGSARSKSLPLSLSLSVSVSSSLASASSPGAAADPTAAFTVTATAPTPASAPFAGKQLNRCRQSCYQQLSKDWHYCKDSVDCTNCCQKLVAPFELRILKAQRQESLVLTDIGWDEMIANASRQCLITWEVSGGGLIGNLLTDTARAELSLWPDTVYNIQVKCKHKLTGLMRRSIKLNVDTSQLVGTTTTTTTSKSSIQRQHLEQPVDHTDALEHSQHIRIPRPTDRVYIISALPTPSELGGVVYPAFGALAFFLALLVMFLFLRPQRKRFPLDADSADTATLIGRSSSSSRNSMDASTLHV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of FEND_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FEND_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FEND_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FEND_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
OPS1_DROME	ninaE	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.