UniProt ID | FEM3_CAEEL | |
---|---|---|
UniProt AC | P34691 | |
Protein Name | Sex-determination protein fem-3 | |
Gene Name | fem-3 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 388 | |
Subcellular Localization | ||
Protein Description | Required for male development. In XO (male) animals, fem-3 directs male differentiation in all tissues. In XX (hermaphrodite) animals, it specifies the first 80 or so germ cells to be sperm. Negatively regulates male development when bound to tra-2. Together with fem-2 associates with the CBC(fem-1) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of tra-1.. | |
Protein Sequence | MEVDPGSDDVEADRETRAQKLKLKRNVKFRAQMRRFDEYCGVTNLTVDDLNWPLISGIPLQRQRLTGATYYDDSLLDQNPWDEFSIDRFLEITSIQLITAGAGYERNDEITRFVFQRTMKTIVTYCNFMYDLARRNGKVQITRFELQDLIHRDEFRFYMYFRQFLPNPDPNCTAFSNHYTSLLHTLYFNIPGMPQFWNNSQMYNYAATRGQRLVQNIAAFYPPEYFWNEDESKYHTTFVVPRGTEFSKFYARRFHEALGMPPLENEIITVLDWLAKLCILEIVYHTTIWCDITGFGGLPRIEHYRLAMENVEDIIFDLAIDDFSISRLQLQISPFEISRYSPLDVSGYYETIKRKKDIEEYQNRFYEVHYSDDVRIMNVYATDCSRKR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of FEM3_CAEEL !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FEM3_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FEM3_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FEM3_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRA1_CAEEL | tra-1 | physical | 17609115 | |
FEM1_CAEEL | fem-1 | physical | 17609115 | |
FEM2_CAEEL | fem-2 | physical | 17609115 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...