dbPTM

FEM3_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FEM3_CAEEL
UniProt AC	P34691
Protein Name	Sex-determination protein fem-3
Gene Name	fem-3
Organism	Caenorhabditis elegans.
Sequence Length	388
Subcellular Localization
Protein Description	Required for male development. In XO (male) animals, fem-3 directs male differentiation in all tissues. In XX (hermaphrodite) animals, it specifies the first 80 or so germ cells to be sperm. Negatively regulates male development when bound to tra-2. Together with fem-2 associates with the CBC(fem-1) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of tra-1..
Protein Sequence	MEVDPGSDDVEADRETRAQKLKLKRNVKFRAQMRRFDEYCGVTNLTVDDLNWPLISGIPLQRQRLTGATYYDDSLLDQNPWDEFSIDRFLEITSIQLITAGAGYERNDEITRFVFQRTMKTIVTYCNFMYDLARRNGKVQITRFELQDLIHRDEFRFYMYFRQFLPNPDPNCTAFSNHYTSLLHTLYFNIPGMPQFWNNSQMYNYAATRGQRLVQNIAAFYPPEYFWNEDESKYHTTFVVPRGTEFSKFYARRFHEALGMPPLENEIITVLDWLAKLCILEIVYHTTIWCDITGFGGLPRIEHYRLAMENVEDIIFDLAIDDFSISRLQLQISPFEISRYSPLDVSGYYETIKRKKDIEEYQNRFYEVHYSDDVRIMNVYATDCSRKR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of FEM3_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FEM3_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FEM3_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FEM3_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRA1_CAEEL	tra-1	physical	17609115
FEM1_CAEEL	fem-1	physical	17609115
FEM2_CAEEL	fem-2	physical	17609115

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FEM3_CAEEL

Related Literatures of Post-Translational Modification