dbPTM

FCERG_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FCERG_MOUSE
UniProt AC	P20491
Protein Name	High affinity immunoglobulin epsilon receptor subunit gamma
Gene Name	Fcer1g
Organism	Mus musculus (Mouse).
Sequence Length	86
Subcellular Localization	Cell membrane Single-pass type I membrane protein.
Protein Description	Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin..
Protein Sequence	MISAVILFLLLLVEQAAALGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREKADAVYTGLNTRSQETYETLKHEKPPQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
57	Phosphorylation	VRKAAIASREKADAV HHHHHHHCHHHHHHH	34.55	23375375
60	Ubiquitination	AAIASREKADAVYTG HHHHCHHHHHHHHHC	50.92	27667366
65	Phosphorylation	REKADAVYTGLNTRS HHHHHHHHHCCCCCC	9.23	25177544
66	Phosphorylation	EKADAVYTGLNTRSQ HHHHHHHHCCCCCCH	28.70	25159016
70	Phosphorylation	AVYTGLNTRSQETYE HHHHCCCCCCHHHHH	36.42	29472430
72	Phosphorylation	YTGLNTRSQETYETL HHCCCCCCHHHHHHH	30.26	27742792
75	Phosphorylation	LNTRSQETYETLKHE CCCCCHHHHHHHHCC	21.01	25159016
76	Phosphorylation	NTRSQETYETLKHEK CCCCHHHHHHHHCCC	13.23	24719451
78	Phosphorylation	RSQETYETLKHEKPP CCHHHHHHHHCCCCC	30.60	26824392
80	Ubiquitination	QETYETLKHEKPPQ- HHHHHHHHCCCCCC-	58.08	-
83	Ubiquitination	YETLKHEKPPQ---- HHHHHCCCCCC----	62.81	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
65	Y	Phosphorylation	Kinase	LYN	P25911	PSP
76	Y	Phosphorylation	Kinase	LYN	P25911	PSP

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FCERG_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FCERG_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CD3Z_MOUSE	Cd247	physical	12426565

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FCERG_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Quantitative time-resolved phosphoproteomic analysis of mast cellsignaling."; Cao L., Yu K., Banh C., Nguyen V., Ritz A., Raphael B.J., Kawakami Y.,Kawakami T., Salomon A.R.; J. Immunol. 179:5864-5876(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-65; TYR-76 AND THR-78,AND MASS SPECTROMETRY.	17947660 [Abstract]