CD3Z_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CD3Z_MOUSE
• UniProt AC: P24161
• Protein Name: T-cell surface glycoprotein CD3 zeta chain
• Gene Name: Cd247
• Organism: Mus musculus (Mouse).
• Sequence Length: 164
• Subcellular Localization: Membrane; Single-pass type I membrane protein.
• Protein Description: Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Plays an important role in intrathymic T-cell differentiation. Additionally, participates in the activity-dependent synapse formation of retinal ganglion cells (RGCs) in both the retina and dorsal lateral geniculate nucleus (dLGN)..
• Protein Sequence: MKWKVSVLACILHVRFPGAEAQSFGLLDPKLCYLLDGILFIYGVIITALYLRAKFSRSAETAANLQDPNQLYNELNLGRREEYDVLEKKRARDPEMGGKQQRRRNPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLAPR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
22	Blocked amino end (Gln)	RFPGAEAQSFGLLDP CCCCHHHHHCCCCCH	30.69	-
22	Blocked amino end	RFPGAEAQSFGLLDP CCCCHHHHHCCCCCH	30.69	-
54	Ubiquitination	TALYLRAKFSRSAET HHHHHHHHHCCCHHH	37.12	-
58	Phosphorylation	LRAKFSRSAETAANL HHHHHCCCHHHHHHC	29.29	-
61	Phosphorylation	KFSRSAETAANLQDP HHCCCHHHHHHCCCH	30.68	22871156
72	Phosphorylation	LQDPNQLYNELNLGR CCCHHHHHHHHHCCC	9.23	25266776
72	Phosphorylation	LQDPNQLYNELNLGR CCCHHHHHHHHHCCC	9.23	25266776
83	Phosphorylation	NLGRREEYDVLEKKR HCCCHHHHHHHHHHH	13.44	25266776
83	Phosphorylation	NLGRREEYDVLEKKR HCCCHHHHHHHHHHH	13.44	25266776
99	Ubiquitination	RDPEMGGKQQRRRNP CCHHCCCHHHHHHCH	37.21	-
111	Phosphorylation	RNPQEGVYNALQKDK HCHHHHHHHHHHHHH	12.94	25266776
111	Phosphorylation	RNPQEGVYNALQKDK HCHHHHHHHHHHHHH	12.94	28833060
123	Phosphorylation	KDKMAEAYSEIGTKG HHHHHHHHHHHCCCC	9.80	25266776
123	Phosphorylation	KDKMAEAYSEIGTKG HHHHHHHHHHHCCCC	9.80	28833060
124	Phosphorylation	DKMAEAYSEIGTKGE HHHHHHHHHHCCCCC	29.77	25266776
124	Phosphorylation	DKMAEAYSEIGTKGE HHHHHHHHHHCCCCC	29.77	28833060
142	Phosphorylation	GKGHDGLYQGLSTAT CCCCCCHHHCCCCCC	13.18	28833060
146	Phosphorylation	DGLYQGLSTATKDTY CCHHHCCCCCCHHHH	23.87	28833060
147	Phosphorylation	GLYQGLSTATKDTYD CHHHCCCCCCHHHHH	43.31	28833060
149	Phosphorylation	YQGLSTATKDTYDAL HHCCCCCCHHHHHHH	29.55	28833060
152	Phosphorylation	LSTATKDTYDALHMQ CCCCCHHHHHHHHHH	25.51	28833060
153	Phosphorylation	STATKDTYDALHMQT CCCCHHHHHHHHHHH	14.89	28833060
160	Phosphorylation	YDALHMQTLAPR--- HHHHHHHHCCCC---	19.81	28833060

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
72	Y	Phosphorylation	Kinase	LCK	P06239	PSP
72	Y	Phosphorylation	Kinase	LCK	P06240	PSP
83	Y	Phosphorylation	Kinase	LCK	P06239	PSP
83	Y	Phosphorylation	Kinase	LCK	P06240	PSP
111	Y	Phosphorylation	Kinase	LCK	P06239	PSP
111	Y	Phosphorylation	Kinase	LCK	P06240	PSP
123	Y	Phosphorylation	Kinase	LCK	P06239	PSP
123	Y	Phosphorylation	Kinase	LCK	P06240	PSP
142	Y	Phosphorylation	Kinase	LCK	P06239	PSP
142	Y	Phosphorylation	Kinase	LCK	P06240	PSP
153	Y	Phosphorylation	Kinase	LCK	P06239	PSP
153	Y	Phosphorylation	Kinase	LCK	P06240	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CD3Z_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CD3Z_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZAP70_MOUSE	Zap70	physical	10358158
FCERG_MOUSE	Fcer1g	physical	12426565
PTN6_MOUSE	Ptpn6	physical	9064344

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.