FBSP1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FBSP1_MOUSE
• UniProt AC: Q8K3B1
• Protein Name: F-box/SPRY domain-containing protein 1
• Gene Name: Fbxo45 {ECO:0000312|EMBL:AAH26799.1, ECO:0000312|MGI:MGI:2447775}
• Organism: Mus musculus (Mouse).
• Sequence Length: 286
• Subcellular Localization: Cell junction, synapse, postsynaptic cell membrane. Cell junction, synapse, presynaptic cell membrane.
• Protein Description: Component of E3 ubiquitin ligase complexes. Required for normal neuromuscular synaptogenesis, axon pathfinding and neuronal migration. Plays a role in the regulation of neurotransmission at mature neurons (By similarity). May control synaptic activity by controlling UNC13A via ubiquitin dependent pathway. Specifically recognizes TP73, promoting its ubiquitination and degradation (By similarity)..
• Protein Sequence: MAAPGPGAGAASGGASGGGAGAGGGASAGSGSSGVGGRLPSRVLELVFSYLELSELRSCALVCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKVRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVILDMEDKTLAFERGYEFLGVAFRGLPKACLYPAVSAVYGNTEVTLVYLGKPLDG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAAPGPGAG ------CCCCCCCCC	23.51	-
12	Phosphorylation	GPGAGAASGGASGGG CCCCCCCCCCCCCCC	36.91	25367039
16	Phosphorylation	GAASGGASGGGAGAG CCCCCCCCCCCCCCC	41.04	25367039
27	Phosphorylation	AGAGGGASAGSGSSG CCCCCCCCCCCCCCC	36.12	25367039
30	Phosphorylation	GGGASAGSGSSGVGG CCCCCCCCCCCCCCC	34.91	25367039
32	Phosphorylation	GASAGSGSSGVGGRL CCCCCCCCCCCCCCC	26.14	25367039
33	Phosphorylation	ASAGSGSSGVGGRLP CCCCCCCCCCCCCCC	40.81	25367039
41	Phosphorylation	GVGGRLPSRVLELVF CCCCCCCHHHHHHHH	39.34	25367039
102	Phosphorylation	DILCNLPSYKAKVRA CHHHCCHHHHHHHHH	42.29	25338131
131	Phosphorylation	YIKKNGFTLHRNPIA EEEECCEEEECCCCC	24.05	28059163

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FBSP1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FBSP1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FBSP1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SKP1_HUMAN	SKP1	physical	19996097

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.