| UniProt ID | FBLN7_HUMAN | |
|---|---|---|
| UniProt AC | Q53RD9 | |
| Protein Name | Fibulin-7 | |
| Gene Name | FBLN7 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 439 | |
| Subcellular Localization | Secreted, extracellular space, extracellular matrix. | |
| Protein Description | An adhesion molecule that interacts with extracellular matrix molecules in developing teeth and may play important roles in differentiation and maintenance of odontoblasts as well as in dentin formation.. | |
| Protein Sequence | MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKSRLAALQNSVGRVGPDALPVSCPALNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVVCLPNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MVPSSPRALFL ----CCCCCHHHHHH | 41.38 | - | |
| 5 | Phosphorylation | ---MVPSSPRALFLL ---CCCCCHHHHHHH | 16.60 | - | |
| 124 | N-linked_Glycosylation | SSVVCLPNGTWTGEQ CCEEECCCCCEECCC | 47.80 | UniProtKB CARBOHYD | |
| 177 | O-linked_Glycosylation | RCQHQAQTAAPEGSV CCHHCCCCCCCCCCC | 28.01 | OGP | |
| 307 | N-linked_Glycosylation | ECPEGSGNVSYVKTS CCCCCCCCEEEEECC | 22.66 | UniProtKB CARBOHYD | |
| 336 | Phosphorylation | PCRHLPKTISFHYLS CCCCCCCEEEEEEEC | 21.66 | - | |
| 338 | Phosphorylation | RHLPKTISFHYLSLP CCCCCEEEEEEECCC | 15.94 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FBLN7_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FBLN7_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FBLN7_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GRP78_HUMAN | HSPA5 | physical | 26186194 | |
| ASPH_HUMAN | ASPH | physical | 26186194 | |
| TXD11_HUMAN | TXNDC11 | physical | 26186194 | |
| ICLN_HUMAN | CLNS1A | physical | 26186194 | |
| EDEM2_HUMAN | EDEM2 | physical | 26186194 | |
| ASPH_HUMAN | ASPH | physical | 28514442 | |
| EDEM2_HUMAN | EDEM2 | physical | 28514442 | |
| TXD11_HUMAN | TXNDC11 | physical | 28514442 | |
| GRP78_HUMAN | HSPA5 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...