FBK49_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FBK49_ARATH
• UniProt AC: Q9SR08
• Protein Name: F-box/kelch-repeat protein At3g04660
• Gene Name: At3g04660
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 390
• Subcellular Localization: Nucleus.
• Protein Description: Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins..
• Protein Sequence: MKKRGRKSKKPEEKRAEYDPSSILPLELKIEILMKSPPKSIAKLGFVSNHWSSIIRGQVFTDLYMRRSLAHPRLLFSVYRPNMQMQFFHSCSQEDPSSDHRSVSYTLNSDLRYSFSPPIGGLIFGQNNTKAMIGNPSTGQFVPLPRIKTQRKHIFSIFGYDPVNDLYKVLCMTVRTLRGPHYFRWEDPMWEEPMTEEHQVFTLGPKQKWRMLECKYLHRHHSGSQGICRDGVMYYLASFNDKRSLMSFDLSSEEFNVTKLPEDYILQQFGNMVDHSGKIAIVSQAYSGPMDLWVLEDVSKEEWSKVAAIVPSITDIVGNDQRVIFRGILSTGEIILSLLPTPKPPFFFLCYDPKEKTARKVVIQGIGEDYAAINVFFDHVESHMVLSKLT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
68	Phosphorylation	TDLYMRRSLAHPRLL HHHHHHHHCCCCEEE	21.39	22074104

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FBK49_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FBK49_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FBK49_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ASK14_ARATH	SK14	physical	23166809
ASK13_ARATH	SK13	physical	23166809

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.