UniProt ID | FAH2A_HUMAN | |
---|---|---|
UniProt AC | Q96GK7 | |
Protein Name | Fumarylacetoacetate hydrolase domain-containing protein 2A | |
Gene Name | FAHD2A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 314 | |
Subcellular Localization | ||
Protein Description | May have hydrolase activity.. | |
Protein Sequence | MLVSGRRRLLTVLLQAQKWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFLEQGEATLSVARRALAAQLPVLPRSEVTFLAPVTRPDKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWQMRRNGKQWLLGKTFDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQSGNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPPGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
94 | Phosphorylation | QLPVLPRSEVTFLAP CCCCCCCCCEEEEEE | 34.18 | 22210691 | |
120 | Ubiquitination | MNYVDHCKEQNVPVP CCCCHHHHHCCCCCC | 59.94 | - | |
120 | 2-Hydroxyisobutyrylation | MNYVDHCKEQNVPVP CCCCHHHHHCCCCCC | 59.94 | - | |
128 | Ubiquitination | EQNVPVPKEPIIFSK HCCCCCCCCCCEEEC | 76.10 | - | |
134 | Phosphorylation | PKEPIIFSKFASSIV CCCCCEEECCCHHCC | 19.22 | 24719451 | |
174 | Malonylation | GKKGKHIKATDAMAH CCCCCCCEEHHHHHH | 44.98 | 26320211 | |
192 | Phosphorylation | FTVAHDVSARDWQMR CEEEEECCHHHHHHH | 24.52 | 22210691 | |
203 | Acetylation | WQMRRNGKQWLLGKT HHHHHCCEEEEECCE | 41.68 | 19608861 | |
203 | Ubiquitination | WQMRRNGKQWLLGKT HHHHHCCEEEEECCE | 41.68 | 19608861 | |
203 | Malonylation | WQMRRNGKQWLLGKT HHHHHCCEEEEECCE | 41.68 | 26320211 | |
209 | Ubiquitination | GKQWLLGKTFDTFCP CEEEEECCEECCCCC | 46.09 | - | |
213 | Phosphorylation | LLGKTFDTFCPLGPA EECCEECCCCCCCCE | 23.97 | 20068231 | |
223 | Phosphorylation | PLGPALVTKDSVADP CCCCEEECCCCCCCC | 29.95 | 20068231 | |
224 | Ubiquitination | LGPALVTKDSVADPH CCCEEECCCCCCCCC | 40.29 | - | |
234 | Malonylation | VADPHNLKICCRVNG CCCCCCCEEEEEECC | 38.73 | 26320211 | |
234 | Ubiquitination | VADPHNLKICCRVNG CCCCCCCEEEEEECC | 38.73 | 19608861 | |
234 | Acetylation | VADPHNLKICCRVNG CCCCCCCEEEEEECC | 38.73 | 22642383 | |
288 | Ubiquitination | PGVGVFRKPPVFLKK CCCCCCCCCCEECCC | 42.06 | - | |
295 | Ubiquitination | KPPVFLKKGDEVQCE CCCEECCCCCEEEEE | 73.98 | - | |
312 | Ubiquitination | ELGVIINKVV----- ECEEEEEECC----- | 33.69 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FAH2A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FAH2A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FAH2A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FAH2B_HUMAN | FAHD2B | physical | 26186194 | |
ODB2_HUMAN | DBT | physical | 26186194 | |
BOLA3_HUMAN | BOLA3 | physical | 26186194 | |
FAH2B_HUMAN | FAHD2B | physical | 28514442 | |
BOLA3_HUMAN | BOLA3 | physical | 28514442 | |
ODB2_HUMAN | DBT | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...