UniProt ID | FABPI_HUMAN | |
---|---|---|
UniProt AC | P12104 | |
Protein Name | Fatty acid-binding protein, intestinal | |
Gene Name | FABP2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 132 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.. | |
Protein Sequence | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAFDSTWKV ------CCCCCCCCC | 19.56 | - | |
12 | Phosphorylation | STWKVDRSENYDKFM CCCCCCCCCCHHHHH | 26.23 | 29759185 | |
15 | Phosphorylation | KVDRSENYDKFMEKM CCCCCCCHHHHHHHH | 19.23 | - | |
49 | Phosphorylation | TQEGNKFTVKESSAF EEECCEEEECCCCCC | 32.07 | 24719451 | |
71 | Phosphorylation | ELGVTFNYNLADGTE EECEEEEEECCCCCE | 13.83 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FABPI_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FABPI_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FABPI_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AGR2_HUMAN | AGR2 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...