FA156_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FA156_HUMAN
• UniProt AC: Q8NDB6
• Protein Name: Protein FAM156A/FAM156B
• Gene Name: FAM156A
• Organism: Homo sapiens (Human).
• Sequence Length: 213
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MDPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPGPSQAVPLPEGLLRQRYREEKTLEERRWERLEFLQRKKAFLRHVRRRHRDHMAPYAVGREARISPLGDRSQNRFRCECRYCQSHRPNLSGIPGESNRAPHPSSWETLVQGLSGLTLSLGTNQPGPLPEAALQPQETEEKRQRERQQESKIMFQRLLKQWLEEN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDPLQKRN -------CCHHHHCC	12.35	22814378
11	Phosphorylation	LQKRNPASPSKSSPM HHHCCCCCCCCCCCC	30.85	24719451
13	Phosphorylation	KRNPASPSKSSPMTA HCCCCCCCCCCCCCH	42.55	28102081
34	Phosphorylation	GPAPSQPSYSEQPMM CCCCCCCCCCCCCCC	33.38	24275569
36	Phosphorylation	APSQPSYSEQPMMGL CCCCCCCCCCCCCCC	33.81	24275569
114	Phosphorylation	VGREARISPLGDRSQ CCCCEEECCCCCCCC	14.44	30266825

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FA156_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FA156_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FA156_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TEX11_HUMAN	TEX11	physical	25416956
ATRIP_HUMAN	ATRIP	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.