dbPTM

ERF92_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ERF92_ARATH
UniProt AC	Q8LDC8
Protein Name	Ethylene-responsive transcription factor 1B
Gene Name	ERF1B
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	218
Subcellular Localization	Nucleus .
Protein Description	Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression during the plant development, and/or mediated by stress factors and by components of stress signal transduction pathways. Seems to be a key integrator of ethylene and jasmonate signals in the regulation of ethylene/jasmonate-dependent defenses. Can mediate resistance to necrotizing fungi (Botrytis cinerea and Plectosphaerella cucumerina) and to soil borne fungi (Fusarium oxysporum conglutinans and Fusiarium oxysporum lycopersici), but probably not to necrotizing bacteria (Pseudomonas syringae tomato)..
Protein Sequence	MDPFLIQSPFSGFSPEYSIGSSPDSFSSSSSNNYSLPFNENDSEEMFLYGLIEQSTQQTYIDSDSQDLPIKSVSSRKSEKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAFSMRGSSAILNFSAERVQESLSEIKYTYEDGCSPVVALKRKHSMRRRMTNKKTKDSDFDHRSVKLDNVVVFEDLGEQYLEELLGSSENSGTW

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ERF92_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ERF92_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ERF92_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ERF92_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
MED25_ARATH	PFT1	physical	21343311
MED25_ARATH	PFT1	physical	22822211

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ERF92_ARATH

Related Literatures of Post-Translational Modification