UniProt ID | ERF92_ARATH | |
---|---|---|
UniProt AC | Q8LDC8 | |
Protein Name | Ethylene-responsive transcription factor 1B | |
Gene Name | ERF1B | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 218 | |
Subcellular Localization | Nucleus . | |
Protein Description | Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression during the plant development, and/or mediated by stress factors and by components of stress signal transduction pathways. Seems to be a key integrator of ethylene and jasmonate signals in the regulation of ethylene/jasmonate-dependent defenses. Can mediate resistance to necrotizing fungi (Botrytis cinerea and Plectosphaerella cucumerina) and to soil borne fungi (Fusarium oxysporum conglutinans and Fusiarium oxysporum lycopersici), but probably not to necrotizing bacteria (Pseudomonas syringae tomato).. | |
Protein Sequence | MDPFLIQSPFSGFSPEYSIGSSPDSFSSSSSNNYSLPFNENDSEEMFLYGLIEQSTQQTYIDSDSQDLPIKSVSSRKSEKSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAFSMRGSSAILNFSAERVQESLSEIKYTYEDGCSPVVALKRKHSMRRRMTNKKTKDSDFDHRSVKLDNVVVFEDLGEQYLEELLGSSENSGTW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ERF92_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERF92_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERF92_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERF92_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MED25_ARATH | PFT1 | physical | 21343311 | |
MED25_ARATH | PFT1 | physical | 22822211 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...