ERF53_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ERF53_ARATH
• UniProt AC: Q9SKT1
• Protein Name: Ethylene-responsive transcription factor ERF053 {ECO:0000305}
• Gene Name: ERF053 {ECO:0000303|PubMed:16407444}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 336
• Subcellular Localization: Nucleus .
• Protein Description: Transcriptional activator involved in abiotic stress tolerance. Can directly regulate stress-related gene expression by binding to the DNA sequence 5'-[AG]CCGAC-3' (DRE element) of their promoter region. Involved in the regulation of stomatal closure movement under drought stress. [PubMed: 23625358 Acts as a positive regulator of drought stress response]
• Protein Sequence: MATAKNKGKSIRVLGTSEAEKKDEMELEEEFQFSSGKYKDSGPGSDMWLGDASSTSPRSLRKTRTFDRHNPYLVSSYATPQPPTTTTCSVSFPFYLPPAIQNQQRFLHPNDPSGQRQQQMISFDPQQQVQPYVAQQQQQQQHLLQYWRDILKLSPSGRMMMMNMLRQESDLPLTRPPVQPFSATKLYRGVRQRHWGKWVAEIRKPRNRTRLWLGTFDTAEEAAMAYDREAFKLRGETARLNFPELFLNKQEPTPVHQKQCETGTTSEDSSRRGEDDSSTALAVGGVSEETGWAEAWFNAIPEEWGPGSPLWDDYHFPISNHKDDLDATQNSSSDTI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
41	Phosphorylation	SSGKYKDSGPGSDMW CCCCCCCCCCCCCCC	42.61	19880383
53	Phosphorylation	DMWLGDASSTSPRSL CCCCCCCCCCCCCHH	38.60	19880383
54	Phosphorylation	MWLGDASSTSPRSLR CCCCCCCCCCCCHHC	34.33	19880383
55	Phosphorylation	WLGDASSTSPRSLRK CCCCCCCCCCCHHCC	40.01	19880383
56	Phosphorylation	LGDASSTSPRSLRKT CCCCCCCCCCHHCCC	21.92	19880383
59	Phosphorylation	ASSTSPRSLRKTRTF CCCCCCCHHCCCCCC	35.59	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ERF53_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ERF53_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ERF53_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RGLG2_ARATH	RGLG2	physical	22095047

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.