UniProt ID | ERF1Y_ARATH | |
---|---|---|
UniProt AC | Q9LPV8 | |
Protein Name | Eukaryotic peptide chain release factor subunit 1-2 | |
Gene Name | ERF1-2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 434 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. [PubMed: 15474304 Modulates plant growth and development] | |
Protein Sequence | MAEEADTNIEIWKIKKLIKGLESARGNGTSMISLIMPPRDQVSRVTKMLGDEYGTASNIKSRVNRQSVLSAITSAQQRLKLYNKVPTNGLVLYTGTIVNDDGKEKKVTFDFEPFRPINASLYLCDNKFHTEALNELLESDDKFGFIVMDGNGTLFGTLSGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKTAELATQFYINPATSQPNVSGLILAGSADFKTELSQSELFDPRLQAKILNVVDVSYGGENGFNQAIELSAEILSNVKFIQEKKLIGKYFEEISQDTGKYVFGVEDTLKALEMGAIETLIVWENLDINRYELKNSTTGEMVVKHFGKDQESDTSNFHDSETNAELEVQEKMPLLEWFANEYKRFGCTLEFVTNKSQEGSQFCRGFGGIGGMLRYQLDMRTFDELSDTEVYEDSD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAEEADTNI ------CCCCCCCCH | 24.28 | 22223895 | |
29 | Phosphorylation | ESARGNGTSMISLIM HHHCCCCCEEEEEEC | 21.08 | 28295753 | |
30 | Phosphorylation | SARGNGTSMISLIMP HHCCCCCEEEEEECC | 18.60 | 28295753 | |
33 | Phosphorylation | GNGTSMISLIMPPRD CCCCEEEEEECCCHH | 11.82 | 28295753 | |
420 | Phosphorylation | RYQLDMRTFDELSDT HEEECCCCHHHHCCC | 28.88 | 23776212 | |
425 | Phosphorylation | MRTFDELSDTEVYED CCCHHHHCCCCEECC | 40.20 | 23776212 | |
427 | Phosphorylation | TFDELSDTEVYEDSD CHHHHCCCCEECCCC | 24.79 | 23776212 | |
433 | Phosphorylation | DTEVYEDSD------ CCCEECCCC------ | 33.02 | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERF1Y_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERF1Y_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERF1Y_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CISY3_ARATH | CSY3 | physical | 21798944 | |
CISY2_ARATH | CSY2 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...