ERF1Y_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ERF1Y_ARATH
• UniProt AC: Q9LPV8
• Protein Name: Eukaryotic peptide chain release factor subunit 1-2
• Gene Name: ERF1-2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 434
• Subcellular Localization: Cytoplasm.
• Protein Description: Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. [PubMed: 15474304 Modulates plant growth and development]
• Protein Sequence: MAEEADTNIEIWKIKKLIKGLESARGNGTSMISLIMPPRDQVSRVTKMLGDEYGTASNIKSRVNRQSVLSAITSAQQRLKLYNKVPTNGLVLYTGTIVNDDGKEKKVTFDFEPFRPINASLYLCDNKFHTEALNELLESDDKFGFIVMDGNGTLFGTLSGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKTAELATQFYINPATSQPNVSGLILAGSADFKTELSQSELFDPRLQAKILNVVDVSYGGENGFNQAIELSAEILSNVKFIQEKKLIGKYFEEISQDTGKYVFGVEDTLKALEMGAIETLIVWENLDINRYELKNSTTGEMVVKHFGKDQESDTSNFHDSETNAELEVQEKMPLLEWFANEYKRFGCTLEFVTNKSQEGSQFCRGFGGIGGMLRYQLDMRTFDELSDTEVYEDSD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAEEADTNI ------CCCCCCCCH	24.28	22223895
29	Phosphorylation	ESARGNGTSMISLIM HHHCCCCCEEEEEEC	21.08	28295753
30	Phosphorylation	SARGNGTSMISLIMP HHCCCCCEEEEEECC	18.60	28295753
33	Phosphorylation	GNGTSMISLIMPPRD CCCCEEEEEECCCHH	11.82	28295753
420	Phosphorylation	RYQLDMRTFDELSDT HEEECCCCHHHHCCC	28.88	23776212
425	Phosphorylation	MRTFDELSDTEVYED CCCHHHHCCCCEECC	40.20	23776212
427	Phosphorylation	TFDELSDTEVYEDSD CHHHHCCCCEECCCC	24.79	23776212
433	Phosphorylation	DTEVYEDSD------ CCCEECCCC------	33.02	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ERF1Y_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ERF1Y_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ERF1Y_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CISY3_ARATH	CSY3	physical	21798944
CISY2_ARATH	CSY2	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.