UniProt ID | CISY3_ARATH | |
---|---|---|
UniProt AC | Q9SJH7 | |
Protein Name | Citrate synthase 3, peroxisomal | |
Gene Name | CSY3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 509 | |
Subcellular Localization | Peroxisome . | |
Protein Description | Peroxisomal citrate synthase required for the fatty acid respiration in seedlings, citrate being exported from peroxisomes into mitochondria during respiration of triacylglycerol (TAG). Indeed, complete respiration requires the transfer of carbon in the form of citrate from the peroxisome to the mitochondria.. | |
Protein Sequence | MEISERVRARLAVLSGHLSEGKQDSPAIERWCTSADTSVAPLGSLKGTLTIVDERTGKNYKVPVSDDGTVKAVDFKKIVTGKEDKGLKLYDPGYLNTAPVRSSISYIDGDEGILRYRGYPIEEMAENSTFLEVAYLLMYGNLPSESQLSDWEFAVSQHSAVPQGVLDIIQSMPHDAHPMGVLVSAMSALSIFHPDANPALRGQDIYDSKQVRDKQIIRIIGKAPTIAAAAYLRMAGRPPVLPSGNLPYADNFLYMLDSLGNRSYKPNPRLARVLDILFILHAEHEMNCSTAAARHLASSGVDVYTAVAGAVGALYGPLHGGANEAVLKMLSEIGTVENIPEFIEGVKNRKRKMSGFGHRVYKNYDPRAKVIKNLADEVFSIVGKDPLIEVAVALEKAALSDDYFVKRKLYPNVDFYSGLIYRAMGFPPEFFTVLFAIPRMAGYLSHWKESLDDPDTKIMRPQQVYTGVWLRHYTPVRERIVTDDSKESDKLGQVATSNASRRRLAGSSV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of CISY3_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CISY3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CISY3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CISY3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CISY1_ARATH | CSY1 | physical | 21798944 | |
SHH2_ARATH | AT3G18380 | physical | 21798944 | |
AAAS_ARATH | AT3G56900 | physical | 21798944 | |
CISY2_ARATH | CSY2 | physical | 21798944 | |
HIBC1_ARATH | CHY1 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...