| UniProt ID | EP3B_HUMAN | |
|---|---|---|
| UniProt AC | P56851 | |
| Protein Name | Epididymal secretory protein E3-beta | |
| Gene Name | EDDM3B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 147 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Possible function in sperm maturation.. | |
| Protein Sequence | MASSLKIWGTLLALLCILCTLLVQSKEVSWREFMKQHYLSPSREFREYKCDVLMRENEALKDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSFNYIEFHCSMDGYVDSIEDLKMVEPIGN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 38 | Phosphorylation | REFMKQHYLSPSREF HHHHHHHCCCCCHHH | 13.33 | 19835603 | |
| 40 | Phosphorylation | FMKQHYLSPSREFRE HHHHHCCCCCHHHHH | 17.42 | 19835603 | |
| 42 | Phosphorylation | KQHYLSPSREFREYK HHHCCCCCHHHHHHH | 40.86 | 19835603 | |
| 64 | Phosphorylation | NEALKDKSSHMFIYI CHHHCCCCCCEEEEE | 35.29 | 29978859 | |
| 65 | Phosphorylation | EALKDKSSHMFIYIS HHHCCCCCCEEEEEE | 25.39 | 29978859 | |
| 70 | Phosphorylation | KSSHMFIYISWYKIE CCCCEEEEEEEEEEE | 4.24 | 29978859 | |
| 72 | Phosphorylation | SHMFIYISWYKIEHI CCEEEEEEEEEEEEE | 13.84 | 29978859 | |
| 74 | Phosphorylation | MFIYISWYKIEHICT EEEEEEEEEEEEEEC | 8.69 | 29978859 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EP3B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EP3B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EP3B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SYNE4_HUMAN | SYNE4 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
