UniProt ID | ELOV3_HUMAN | |
---|---|---|
UniProt AC | Q9HB03 | |
Protein Name | Elongation of very long chain fatty acids protein 3 {ECO:0000255|HAMAP-Rule:MF_03203, ECO:0000305} | |
Gene Name | ELOVL3 {ECO:0000255|HAMAP-Rule:MF_03203} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 270 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Catalyzes the first and rate-limiting reaction of the four that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. Condensing enzyme with higher activity toward C18 acyl-CoAs, especially C18:0 acyl-CoAs. May participate in the production of saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.. | |
Protein Sequence | MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | N-linked_Glycosylation | --MVTAMNVSHEVNQ --CCCCCCCCHHHHH | 29.67 | - | |
110 | N-linked_Glycosylation | CFINFIDNSTVKFWS EEEEEECCCHHHHHH | 34.46 | UniProtKB CARBOHYD | |
131 | Phosphorylation | KVIELGDTAFIILRK HHHHHCCEEEEEEEC | 22.97 | 24719451 | |
203 | Phosphorylation | KMLPMLITSLQILQM CHHHHHHHHHHHHHH | 21.30 | - | |
204 | Phosphorylation | MLPMLITSLQILQMF HHHHHHHHHHHHHHH | 15.98 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ELOV3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ELOV3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ELOV3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MUC20_HUMAN | MUC20 | physical | 21988832 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...