ELMD2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ELMD2_HUMAN
• UniProt AC: Q8IZ81
• Protein Name: ELMO domain-containing protein 2
• Gene Name: ELMOD2
• Organism: Homo sapiens (Human).
• Sequence Length: 293
• Protein Description: Acts as a GTPase-activating protein (GAP) toward guanine nucleotide exchange factors like ARL2, ARL3, ARF1 and ARF6, but not for GTPases outside the Arf family. Regulates IFN-related antiviral responses..
• Protein Sequence: MFISLWEFFYGHFFRFWMKWLLRQMTGKCELQRIFDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQHEELLMKLWNLLMPTKKLNARISKQWAEIGFQGDDPKTDFRGMGILGLINLVYFSENYTSEAHQILSRSNHPKLGYSYAIVGINLTEMAYSLLKSEALKFHLYNLVPGIPTMEHFHQFYCYLVYEFDKFWFEEEPESIMYFNLYREKFHEKIKGLLLDCNVALTLKV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
28	Ubiquitination	LLRQMTGKCELQRIF HHHHHCCCHHHHHHH	18.50	24816145
37	Phosphorylation	ELQRIFDTYVGAQRT HHHHHHHHHCCCCCC	14.90	24670416
38	Phosphorylation	LQRIFDTYVGAQRTH HHHHHHHHCCCCCCC	9.95	26270265
40	Ubiquitination	RIFDTYVGAQRTHRI HHHHHHCCCCCCCCC	12.94	24816145
54	Phosphorylation	IENSLTYSKNKVLQK CCCCCCCCHHHHHHH	25.23	25954137
55	Acetylation	ENSLTYSKNKVLQKA CCCCCCCHHHHHHHH	50.83	19413330
55	Ubiquitination	ENSLTYSKNKVLQKA CCCCCCCHHHHHHHH	50.83	22817900
57	Ubiquitination	SLTYSKNKVLQKATH CCCCCHHHHHHHHHH	48.32	22817900
61	Ubiquitination	SKNKVLQKATHVVQS CHHHHHHHHHHHHHH	51.60	21906983
63	Phosphorylation	NKVLQKATHVVQSEV HHHHHHHHHHHHHHH	23.41	22210691
67	Ubiquitination	QKATHVVQSEVDKYV HHHHHHHHHHHHHHH	32.55	22817900
69	Ubiquitination	ATHVVQSEVDKYVDD HHHHHHHHHHHHHHH	37.33	22817900
73	Ubiquitination	VQSEVDKYVDDIMKE HHHHHHHHHHHHHHH	12.49	21890473
73	Phosphorylation	VQSEVDKYVDDIMKE HHHHHHHHHHHHHHH	12.49	22210691
87	Ubiquitination	EKNINPEKDASFKIC HCCCCCCCCHHHHHH	60.91	29967540
90	Phosphorylation	INPEKDASFKICMKM CCCCCCHHHHHHHHH	36.89	24719451
94	S-palmitoylation	KDASFKICMKMCLLQ CCHHHHHHHHHHHHH	1.90	25904333
98	S-palmitoylation	FKICMKMCLLQITGY HHHHHHHHHHHHHCC	2.60	25904333
150	Ubiquitination	KLNARISKQWAEIGF HHCHHHHHHHHHHCC	47.70	22817900
162	Ubiquitination	IGFQGDDPKTDFRGM HCCCCCCCCCCCCCC	46.30	21890473
163	Ubiquitination	GFQGDDPKTDFRGMG CCCCCCCCCCCCCCH	68.66	23503661
175	Ubiquitination	GMGILGLINLVYFSE CCHHHHHHHHHEECC	3.39	23503661
204	Phosphorylation	HPKLGYSYAIVGINL CCCCCCCEEEEEEEH	7.58	-
216	Phosphorylation	INLTEMAYSLLKSEA EEHHHHHHHHHHHHH	9.88	24719451
217	Phosphorylation	NLTEMAYSLLKSEAL EHHHHHHHHHHHHHH	20.07	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ELMD2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ELMD2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ELMD2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HXC4_HUMAN	HOXC4	physical	21988832

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.