UniProt ID | EFNA2_HUMAN | |
---|---|---|
UniProt AC | O43921 | |
Protein Name | Ephrin-A2 | |
Gene Name | EFNA2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 213 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . |
|
Protein Description | Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. With the EPHA2 receptor may play a role in bone remodeling through regulation of osteoclastogenesis and osteoblastogenesis (By similarity).. | |
Protein Sequence | MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
42 | N-linked_Glycosylation | DRYAVYWNRSNPRFH CCEEEEECCCCCCEE | 21.58 | UniProtKB CARBOHYD | |
125 | Acetylation | AAPGGPLKFSEKFQL CCCCCCCCCCCEECE | 50.40 | 7289869 | |
127 | Phosphorylation | PGGPLKFSEKFQLFT CCCCCCCCCEECEEC | 37.99 | 24719451 | |
174 | N-linked_Glycosylation | KVYVRPTNETLYEAP EEEECCCCCCCEECC | 42.83 | UniProtKB CARBOHYD | |
188 | N-linked_Glycosylation | PEPIFTSNNSCSSPG CCCEECCCCCCCCCC | 41.18 | UniProtKB CARBOHYD | |
188 | GPI-anchor | PEPIFTSNNSCSSPG CCCEECCCCCCCCCC | 41.18 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EFNA2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EFNA2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EFNA2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ADA10_HUMAN | ADAM10 | physical | 10958785 | |
EPHA7_HUMAN | EPHA7 | physical | 10366629 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...