| UniProt ID | EF1B_SCHPO | |
|---|---|---|
| UniProt AC | O74173 | |
| Protein Name | Elongation factor 1-beta | |
| Gene Name | tef5 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 214 | |
| Subcellular Localization | ||
| Protein Description | EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.. | |
| Protein Sequence | MGFSDLTSDAGLKQLNDFLLDKSFIEGYEPSQADAVVFKAVGVAPDTAKYPNGARWYKQIATYDLATLPGTAKEVSAYGPEGAAAAEEDEIDLFGSDEEEDPEAERIKAERVAEYNKKKAAKPKAVHKSLVTLDVKPWDDETPMDELEKAVRSIQMDGLVWGLSKLVPVGFGVNKFQINLVVEDDKVSLEALQEELEGFEDYVQSTDIAAMSKL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MGFSDLTSDAGLKQ -CCHHHHCCHHHHHH | 29.56 | 29996109 | |
| 8 | Phosphorylation | MGFSDLTSDAGLKQL CCHHHHCCHHHHHHH | 32.53 | 28889911 | |
| 23 | Phosphorylation | NDFLLDKSFIEGYEP HHHHHCHHHHCCCCH | 30.99 | 25720772 | |
| 76 | Phosphorylation | PGTAKEVSAYGPEGA CCCCHHHHHHCCCCC | 19.50 | 21712547 | |
| 96 | Phosphorylation | DEIDLFGSDEEEDPE CCCCCCCCCCCCCHH | 34.22 | 28889911 | |
| 129 | Phosphorylation | KPKAVHKSLVTLDVK CCCCCCCHHEEECCC | 17.13 | 24763107 | |
| 153 | Phosphorylation | ELEKAVRSIQMDGLV HHHHHHHHHHHCCHH | 15.58 | 25720772 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EF1B_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EF1B_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EF1B_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TCTP_SCHPO | SPAC1F12.02c | physical | 25635048 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...