EF1B_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EF1B_SCHPO
• UniProt AC: O74173
• Protein Name: Elongation factor 1-beta
• Gene Name: tef5
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 214
• Protein Description: EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP..
• Protein Sequence: MGFSDLTSDAGLKQLNDFLLDKSFIEGYEPSQADAVVFKAVGVAPDTAKYPNGARWYKQIATYDLATLPGTAKEVSAYGPEGAAAAEEDEIDLFGSDEEEDPEAERIKAERVAEYNKKKAAKPKAVHKSLVTLDVKPWDDETPMDELEKAVRSIQMDGLVWGLSKLVPVGFGVNKFQINLVVEDDKVSLEALQEELEGFEDYVQSTDIAAMSKL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MGFSDLTSDAGLKQ -CCHHHHCCHHHHHH	29.56	29996109
8	Phosphorylation	MGFSDLTSDAGLKQL CCHHHHCCHHHHHHH	32.53	28889911
23	Phosphorylation	NDFLLDKSFIEGYEP HHHHHCHHHHCCCCH	30.99	25720772
76	Phosphorylation	PGTAKEVSAYGPEGA CCCCHHHHHHCCCCC	19.50	21712547
96	Phosphorylation	DEIDLFGSDEEEDPE CCCCCCCCCCCCCHH	34.22	28889911
129	Phosphorylation	KPKAVHKSLVTLDVK CCCCCCCHHEEECCC	17.13	24763107
153	Phosphorylation	ELEKAVRSIQMDGLV HHHHHHHHHHHCCHH	15.58	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of EF1B_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of EF1B_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EF1B_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TCTP_SCHPO	SPAC1F12.02c	physical	25635048

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.