EDIL3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EDIL3_HUMAN
• UniProt AC: O43854
• Protein Name: EGF-like repeat and discoidin I-like domain-containing protein 3
• Gene Name: EDIL3
• Organism: Homo sapiens (Human).
• Sequence Length: 480
• Subcellular Localization: Secreted.
• Protein Description: Promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. Inhibits formation of vascular-like structures. May be involved in regulation of vascular morphogenesis of remodeling in embryonic development..
• Protein Sequence: MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
73	O-linked_Glycosylation	ASDEEEPTSAGPCTP CCCCCCCCCCCCCCC	34.19	22601780
88	O-linked_Glycosylation	NPCHNGGTCEISEAY CCCCCCCEEEECCCC	14.36	22601780
99	Phosphorylation	SEAYRGDTFIGYVCK CCCCCCCCEEEEEEC	21.70	24719451
103	Phosphorylation	RGDTFIGYVCKCPRG CCCCEEEEEECCCCC	9.62	24719451
140	N-linked_Glycosylation	ICTDLVANYSCECPG CCCHHHCCEECCCCC	23.05	22601780
234 (in isoform 2)	Ubiquitination	-	6.53	21890473
234	Ubiquitination	TGVITQGAKRIGSPE EEEEECCCCCCCCHH	6.53	21890473
235	2-Hydroxyisobutyrylation	GVITQGAKRIGSPEY EEEECCCCCCCCHHH	51.91	-
237	Ubiquitination	ITQGAKRIGSPEYIK EECCCCCCCCHHHHH	6.71	23000965
244	Ubiquitination	IGSPEYIKSYKIAYS CCCHHHHHEEEEEEC	47.00	21890473
244 (in isoform 1)	Ubiquitination	-	47.00	21890473
244	Ubiquitination	IGSPEYIKSYKIAYS CCCHHHHHEEEEEEC	47.00	23000965
245	Ubiquitination	GSPEYIKSYKIAYSN CCHHHHHEEEEEECC	23.31	23000965
246	Phosphorylation	SPEYIKSYKIAYSND CHHHHHEEEEEECCC	11.04	-
247	Ubiquitination	PEYIKSYKIAYSNDG HHHHHEEEEEECCCC	28.13	23000965
250	Phosphorylation	IKSYKIAYSNDGKTW HHEEEEEECCCCCEE	16.10	22817900
251	Ubiquitination	KSYKIAYSNDGKTWA HEEEEEECCCCCEEE	21.30	23000965
255	Ubiquitination	IAYSNDGKTWAMYKV EEECCCCCEEEEEEE	43.70	23000965
260	Phosphorylation	DGKTWAMYKVKGTNE CCCEEEEEEEECCCC	12.60	22817900
261	Ubiquitination	GKTWAMYKVKGTNED CCEEEEEEEECCCCC	25.12	23000965
336	O-linked_Glycosylation	HIQDYQITASSIFRT CCCCEEEEHHHHHHH	12.64	55829663
339	Phosphorylation	DYQITASSIFRTLNM CEEEEHHHHHHHHCC	24.23	24719451
452	Phosphorylation	NVIDPPIYARHIRIL CCCCCCCCCCEEEEE	11.89	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of EDIL3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of EDIL3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EDIL3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRFE_HUMAN	TF	physical	26186194
ITB5_HUMAN	ITGB5	physical	26186194
AGRL1_HUMAN	LPHN1	physical	26186194
ITB5_HUMAN	ITGB5	physical	28514442
ZN496_HUMAN	ZNF496	physical	28514442
TRFE_HUMAN	TF	physical	28514442
AGRL1_HUMAN	LPHN1	physical	28514442
ITAV_HUMAN	ITGAV	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.