UniProt ID | DWA2_ARATH | |
---|---|---|
UniProt AC | Q6NPN9 | |
Protein Name | WD repeat-containing protein DWA2 | |
Gene Name | DWA2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 350 | |
Subcellular Localization | Nucleus . | |
Protein Description | Component of the CUL4-RBX1-DDB1-DWA1/DWA2 E3 ubiquitin-protein ligase complex that acts as negative regulator in abscisic acid (ABA) signaling. May function as the substrate recognition module within this complex leading to ABI5 degradation. Functionally redundant with DWA1.. | |
Protein Sequence | MQGGSSGIGYGLKYQARCISDVKADRDHTSFLTGTLSLKEENEVHLLRLSSGGSELLCEGLFSHPNEIWDLASSPFDQRIFSTVFSTGDSYGAAIWQIPEPYGQSNSSTLECVASLDAHVGKINCVLWCPSGNSDKLISMDEQNLVFWSLDSSKKSAEVLSKESAGMRHSLSGGAWNPHDVNSVAATSESSIQFWDLRTMKKNNSIERAHVRNVDYNLKREHILVSADDESGIHLWDLRKTKFPVQELPGHTHWTWAVRCNPEYEELILSVGTDSAVNLWFASASSEHKTSESPVEASRQRVNPLLNSYTDYEDSVYGLAWSSREPWIFASLSYDGRVVIESVKPFLPRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DWA2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DWA2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DWA2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CUL4_ARATH | CUL4 | physical | 20525848 | |
DDB1B_ARATH | DDB1B | physical | 20525848 | |
ABI5_ARATH | ABI5 | physical | 20525848 | |
THOC6_ARATH | DWA1 | physical | 20525848 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...