dbPTM

DWA2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DWA2_ARATH
UniProt AC	Q6NPN9
Protein Name	WD repeat-containing protein DWA2
Gene Name	DWA2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	350
Subcellular Localization	Nucleus .
Protein Description	Component of the CUL4-RBX1-DDB1-DWA1/DWA2 E3 ubiquitin-protein ligase complex that acts as negative regulator in abscisic acid (ABA) signaling. May function as the substrate recognition module within this complex leading to ABI5 degradation. Functionally redundant with DWA1..
Protein Sequence	MQGGSSGIGYGLKYQARCISDVKADRDHTSFLTGTLSLKEENEVHLLRLSSGGSELLCEGLFSHPNEIWDLASSPFDQRIFSTVFSTGDSYGAAIWQIPEPYGQSNSSTLECVASLDAHVGKINCVLWCPSGNSDKLISMDEQNLVFWSLDSSKKSAEVLSKESAGMRHSLSGGAWNPHDVNSVAATSESSIQFWDLRTMKKNNSIERAHVRNVDYNLKREHILVSADDESGIHLWDLRKTKFPVQELPGHTHWTWAVRCNPEYEELILSVGTDSAVNLWFASASSEHKTSESPVEASRQRVNPLLNSYTDYEDSVYGLAWSSREPWIFASLSYDGRVVIESVKPFLPRR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
291	Phosphorylation	ASSEHKTSESPVEAS CCCCCCCCCCHHHHH	40.66	29654922
293	Phosphorylation	SEHKTSESPVEASRQ CCCCCCCCHHHHHHH	33.73	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DWA2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DWA2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DWA2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CUL4_ARATH	CUL4	physical	20525848
DDB1B_ARATH	DDB1B	physical	20525848
ABI5_ARATH	ABI5	physical	20525848
THOC6_ARATH	DWA1	physical	20525848

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DWA2_ARATH

Related Literatures of Post-Translational Modification