dbPTM

DRM_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DRM_DROME
UniProt AC	Q9VQS6
Protein Name	Protein drumstick
Gene Name	drm {ECO:0000312\|EMBL:AAF51088.2}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	81
Subcellular Localization	Nucleus .
Protein Description	Putative transcription factor. May function redundantly with odd and sob in leg joint formation during the larval stages, acting downstream of Notch activation. Acts in a hierarchy during foregut and hindgut patterning and morphogenesis, antagonizing lin to relieve the repressive effect on bowl. Involved in cell rearrangement during elongation of the embryonic hindgut. Regulates expression of hindgut patterning genes to establish the small intestine region of the embryonic hindgut. Required in the foregut for spatially localized gene expression and morphogenesis of the proventriculus..
Protein Sequence	MFAVMRIDNDDCRSDFRRKMRPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRCSQCVWR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of DRM_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DRM_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DRM_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DRM_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
BOWEL_DROME	bowl	genetic	17021046

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DRM_DROME

Related Literatures of Post-Translational Modification