UniProt ID | DRM_DROME | |
---|---|---|
UniProt AC | Q9VQS6 | |
Protein Name | Protein drumstick | |
Gene Name | drm {ECO:0000312|EMBL:AAF51088.2} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 81 | |
Subcellular Localization | Nucleus . | |
Protein Description | Putative transcription factor. May function redundantly with odd and sob in leg joint formation during the larval stages, acting downstream of Notch activation. Acts in a hierarchy during foregut and hindgut patterning and morphogenesis, antagonizing lin to relieve the repressive effect on bowl. Involved in cell rearrangement during elongation of the embryonic hindgut. Regulates expression of hindgut patterning genes to establish the small intestine region of the embryonic hindgut. Required in the foregut for spatially localized gene expression and morphogenesis of the proventriculus.. | |
Protein Sequence | MFAVMRIDNDDCRSDFRRKMRPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRCSQCVWR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of DRM_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DRM_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DRM_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DRM_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BOWEL_DROME | bowl | genetic | 17021046 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...