UniProt ID | DRG1_MOUSE | |
---|---|---|
UniProt AC | P32233 | |
Protein Name | Developmentally-regulated GTP-binding protein 1 | |
Gene Name | Drg1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 367 | |
Subcellular Localization | Cytoplasm. The DRG1-DFRP2/ZC3H15 complex associates with polysomes.. | |
Protein Description | Critical regulator of cell growth under specific conditions. Implicated in differentiation and cell cycle arrest.. | |
Protein Sequence | MSGTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSGTLAKIA ------CCCHHHHHH | 40.25 | - | |
7 | Ubiquitination | -MSGTLAKIAEIEAE -CCCHHHHHHHHHHH | 45.63 | 22790023 | |
22 | Hydroxylation | MARTQKNKATAHHLG HHHHHHCHHHHHHHH | 54.90 | - | |
46 | Ubiquitination | RRELITPKGGGGGGP HHHHCCCCCCCCCCC | 62.63 | 22790023 | |
100 | Phosphorylation | AYEFTTLTTVPGVIR CEECCCCCCCCCEEE | 24.53 | - | |
112 | Ubiquitination | VIRYKGAKIQLLDLP EEEECCCEEEEEECC | 39.39 | 22790023 | |
126 | Ubiquitination | PGIIEGAKDGKGRGR CCHHCCCCCCCCCCH | 77.27 | 22790023 | |
159 | Ubiquitination | LKPLGHKKIIENELE HHHHCCHHHHHCHHC | 43.15 | 22790023 | |
175 | Ubiquitination | FGIRLNSKPPNIGFK CCEECCCCCCCCCCC | 64.52 | 22790023 | |
186 | Ubiquitination | IGFKKKDKGGINLTA CCCCCCCCCCEECEE | 68.84 | - | |
213 | Ubiquitination | KSILAEYKIHNADVT HHHHHHHCCCCCCEE | 29.06 | 22790023 | |
290 | Ubiquitination | EKIWDYLKLVRIYTK HHHHHHHHHHHHCCC | 38.41 | 22790023 | |
299 | Ubiquitination | VRIYTKPKGQLPDYT HHHCCCCCCCCCCCC | 61.93 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
100 | T | Phosphorylation | Kinase | STK16 | O88697 | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
22 | K | Hydroxylation |
| - |
100 | T | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DRG1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ZC3HF_MOUSE | Zc3h15 | physical | 15676025 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...