| UniProt ID | DRD5_HUMAN | |
|---|---|---|
| UniProt AC | P21918 | |
| Protein Name | D(1B) dopamine receptor | |
| Gene Name | DRD5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 477 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
| Protein Description | Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.. | |
| Protein Sequence | MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVLVCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFDIMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNWHRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | N-linked_Glycosylation | -MLPPGSNGTAYPGQ -CCCCCCCCCCCCCH | 58.72 | 10531415 | |
| 222 | N-linked_Glycosylation | ENCDSSLNRTYAISS HHCCCCCCHHHHHCH | 35.87 | UniProtKB CARBOHYD | |
| 249 | Phosphorylation | IVTYTRIYRIAQVQI HHHHHHHHHHHHHHH | 7.83 | - | |
| 375 | S-palmitoylation | VFAQLLGCSHFCSRT HHHHHHCCCHHHCCC | 2.63 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DRD5_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DRD5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DRD5_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GNA13_HUMAN | GNA13 | physical | 12623966 | |
| GNA12_HUMAN | GNA12 | physical | 12623966 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 606798 | Benign essential blepharospasm (BEB) | |||||
| Kegg Drug | ||||||
| D00059 | Levodopa (JP16/USP/INN); Dopar (TN) | |||||
| D00633 | Dopamine hydrochloride (JP16/USP); Actopamin (TN); Intropin (TN) | |||||
| D02676 | Oxiperomide (USAN/INN) | |||||
| D03891 | Dopexamine (USAN/INN) | |||||
| D03937 | Ecopipam hydrochloride (USAN) | |||||
| D07870 | Dopamine (INN); Medopa (TN) | |||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "N-linked glycosylation is required for plasma membrane localizationof D5, but not D1, dopamine receptors in transfected mammaliancells."; Karpa K.D., Lidow M.S., Pickering M.T., Levenson R., Bergson C.; Mol. Pharmacol. 56:1071-1078(1999). Cited for: GLYCOSYLATION AT ASN-7, AND MUTAGENESIS OF ASN-7. | |