UniProt ID | DRD5_HUMAN | |
---|---|---|
UniProt AC | P21918 | |
Protein Name | D(1B) dopamine receptor | |
Gene Name | DRD5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 477 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
Protein Description | Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.. | |
Protein Sequence | MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVLVCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFDIMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNWHRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | N-linked_Glycosylation | -MLPPGSNGTAYPGQ -CCCCCCCCCCCCCH | 58.72 | 10531415 | |
222 | N-linked_Glycosylation | ENCDSSLNRTYAISS HHCCCCCCHHHHHCH | 35.87 | UniProtKB CARBOHYD | |
249 | Phosphorylation | IVTYTRIYRIAQVQI HHHHHHHHHHHHHHH | 7.83 | - | |
375 | S-palmitoylation | VFAQLLGCSHFCSRT HHHHHHCCCHHHCCC | 2.63 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DRD5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DRD5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DRD5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GNA13_HUMAN | GNA13 | physical | 12623966 | |
GNA12_HUMAN | GNA12 | physical | 12623966 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
606798 | Benign essential blepharospasm (BEB) | |||||
Kegg Drug | ||||||
D00059 | Levodopa (JP16/USP/INN); Dopar (TN) | |||||
D00633 | Dopamine hydrochloride (JP16/USP); Actopamin (TN); Intropin (TN) | |||||
D02676 | Oxiperomide (USAN/INN) | |||||
D03891 | Dopexamine (USAN/INN) | |||||
D03937 | Ecopipam hydrochloride (USAN) | |||||
D07870 | Dopamine (INN); Medopa (TN) | |||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"N-linked glycosylation is required for plasma membrane localizationof D5, but not D1, dopamine receptors in transfected mammaliancells."; Karpa K.D., Lidow M.S., Pickering M.T., Levenson R., Bergson C.; Mol. Pharmacol. 56:1071-1078(1999). Cited for: GLYCOSYLATION AT ASN-7, AND MUTAGENESIS OF ASN-7. |