UniProt ID | DPOD4_HUMAN | |
---|---|---|
UniProt AC | Q9HCU8 | |
Protein Name | DNA polymerase delta subunit 4 | |
Gene Name | POLD4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 107 | |
Subcellular Localization | Nucleus . Partially recruited to DNA damage sites within 2 hours following UV irradiation, before degradation. | |
Protein Description | As a component of the tetrameric DNA polymerase delta complex (Pol-delta4), plays a role in high fidelity genome replication and repair. Within this complex, increases the rate of DNA synthesis and decreases fidelity by regulating POLD1 polymerase and proofreading 3' to 5' exonuclease activity. [PubMed: 16510448] | |
Protein Sequence | MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MGRKRLITDSYPVVK CCCCCCCCCCCCEEE | 24.39 | 18212344 | |
10 | Phosphorylation | RKRLITDSYPVVKRR CCCCCCCCCCEEECC | 23.76 | 28555341 | |
15 | Ubiquitination | TDSYPVVKRREGPAG CCCCCEEECCCCCCC | 46.07 | PubMed | |
25 | Acetylation | EGPAGHSKGELAPEL CCCCCCCCCCCCHHH | 51.21 | 11492433 | |
25 | Ubiquitination | EGPAGHSKGELAPEL CCCCCCCCCCCCHHH | 51.21 | 2190698 | |
74 | Ubiquitination | LQRWCRAKQMGLEPP HHHHHHHHHCCCCCC | 22.82 | PubMed | |
89 | Ubiquitination | PEVWQVLKTHPGDPR HHHHHHHHCCCCCCC | 46.03 | PubMed |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DPOD4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DPOD4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DPOE1_HUMAN | POLE | physical | 21705323 | |
PCNA_HUMAN | PCNA | physical | 16510448 | |
DPOD1_HUMAN | POLD1 | physical | 16510448 | |
DPOD3_HUMAN | POLD3 | physical | 16510448 | |
DPOD2_HUMAN | POLD2 | physical | 16510448 | |
PCNA_HUMAN | PCNA | physical | 24022480 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...