DPM2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DPM2_HUMAN
• UniProt AC: O94777
• Protein Name: Dolichol phosphate-mannose biosynthesis regulatory protein
• Gene Name: DPM2
• Organism: Homo sapiens (Human).
• Sequence Length: 84
• Subcellular Localization: Endoplasmic reticulum membrane; Multi-pass membrane protein.
• Protein Description: Regulates the biosynthesis of dolichol phosphate-mannose. Regulatory subunit of the dolichol-phosphate mannose (DPM) synthase complex; essential for the ER localization and stable expression of DPM1. When associated with the GPI-GlcNAc transferase (GPI-GnT) complex enhances but is not essential for its activity..
• Protein Sequence: MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISYVMLKTKRVTKKAQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of DPM2_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DPM2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DPM2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DPM2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PIGP_HUMAN	PIGP	physical	10944123

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.