UniProt ID | DMAC1_HUMAN | |
---|---|---|
UniProt AC | Q96GE9 | |
Protein Name | Distal membrane-arm assembly complex protein 1 {ECO:0000303|PubMed:27626371} | |
Gene Name | DMAC1 {ECO:0000303|PubMed:27626371, ECO:0000312|HGNC:HGNC:30536} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 116 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Required for the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Involved in the assembly of the distal region of complex I.. | |
Protein Sequence | MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSCRVLSGLGLMGAGGYVYWVARKPMKMGYPPSPWTITQMVIGLSENQGIATWGIVVMADPKGKAYRVV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
25 | Ubiquitination | GTAAAPAKPAPPATP CCCCCCCCCCCCCCC | 29967540 | ||
31 | Phosphorylation | AKPAPPATPGAPTSP CCCCCCCCCCCCCCH | 25159151 | ||
36 | Phosphorylation | PATPGAPTSPAEHRL CCCCCCCCCHHHHHH | 25627689 | ||
37 | Phosphorylation | ATPGAPTSPAEHRLL CCCCCCCCHHHHHHH | 25849741 | ||
54 | Phosphorylation | CWSCRVLSGLGLMGA HHHHHHHHCCCCCCC | 29116813 | ||
64 | Phosphorylation | GLMGAGGYVYWVARK CCCCCCCEEEEEECC | 29116813 | ||
66 | Phosphorylation | MGAGGYVYWVARKPM CCCCCEEEEEECCCC | 29116813 | ||
80 | Phosphorylation | MKMGYPPSPWTITQM CCCCCCCCCCCEEEE | 22210691 | ||
83 | Phosphorylation | GYPPSPWTITQMVIG CCCCCCCCEEEEEEE | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DMAC1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DMAC1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DMAC1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...