UniProt ID | DJC28_HUMAN | |
---|---|---|
UniProt AC | Q9NX36 | |
Protein Name | DnaJ homolog subfamily C member 28 | |
Gene Name | DNAJC28 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 388 | |
Subcellular Localization | ||
Protein Description | May have a role in protein folding or as a chaperone.. | |
Protein Sequence | MNTMYVMMAQILRSHLIKATVIPNRVKMLPYFGIIRNRMMSTHKSKKKIREYYRLLNVEEGCSADEVRESFHKLAKQYHPDSGSNTADSATFIRIEKAYRKVLSHVIEQTNASQSKGEEEEDVEKFKYKTPQHRHYLSFEGIGFGTPTQREKHYRQFRADRAAEQVMEYQKQKLQSQYFPDSVIVKNIRQSKQQKITQAIERLVEDLIQESMAKGDFDNLSGKGKPLKKFSDCSYIDPMTHNLNRILIDNGYQPEWILKQKEISDTIEQLREAILVSRKKLGNPMTPTEKKQWNHVCEQFQENIRKLNKRINDFNLIVPILTRQKVHFDAQKEIVRAQKIYETLIKTKEVTDRNPNNLDQGEGEKTPEIKKGFLNWMNLWKFIKIRSF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MNTMYVMMAQ -----CCHHHHHHHH | 14.47 | 24043423 | |
5 | Phosphorylation | ---MNTMYVMMAQIL ---CCHHHHHHHHHH | 5.33 | 24043423 | |
14 | Phosphorylation | MMAQILRSHLIKATV HHHHHHHHHHCHHEE | 21.14 | 24043423 | |
20 | Phosphorylation | RSHLIKATVIPNRVK HHHHCHHEECCCCCC | 17.61 | 24043423 | |
31 | Phosphorylation | NRVKMLPYFGIIRNR CCCCCHHHHHHHHHH | 15.52 | 22817900 | |
76 | Acetylation | ESFHKLAKQYHPDSG HHHHHHHHHHCCCCC | 62.92 | 19821069 | |
84 | Phosphorylation | QYHPDSGSNTADSAT HHCCCCCCCCCCCHH | 34.65 | - | |
97 | Acetylation | ATFIRIEKAYRKVLS HHHHHHHHHHHHHHH | 48.63 | 19821077 | |
128 | Phosphorylation | EDVEKFKYKTPQHRH HHHHHHCCCCCCCCC | 24.19 | 24719451 | |
130 | Phosphorylation | VEKFKYKTPQHRHYL HHHHCCCCCCCCCEE | 25.70 | 24719451 | |
169 | Phosphorylation | AAEQVMEYQKQKLQS HHHHHHHHHHHHHHH | 11.69 | 27642862 | |
223 | Ubiquitination | DFDNLSGKGKPLKKF CHHHCCCCCCCCCCC | 61.46 | 22817900 | |
225 | Ubiquitination | DNLSGKGKPLKKFSD HHCCCCCCCCCCCCC | 51.14 | 22817900 | |
228 | Ubiquitination | SGKGKPLKKFSDCSY CCCCCCCCCCCCCCC | 61.37 | 22817900 | |
229 | Ubiquitination | GKGKPLKKFSDCSYI CCCCCCCCCCCCCCC | 58.76 | 22817900 | |
252 | Phosphorylation | RILIDNGYQPEWILK HHEECCCCCCHHHHC | 27.44 | 27174698 | |
286 | Phosphorylation | KKLGNPMTPTEKKQW HHHCCCCCCCHHHHH | 28.46 | 23403867 | |
288 | Phosphorylation | LGNPMTPTEKKQWNH HCCCCCCCHHHHHHH | 51.80 | 26657352 | |
341 | Phosphorylation | IVRAQKIYETLIKTK HHHHHHHHHHHHHHH | 15.19 | 20049867 | |
347 | Phosphorylation | IYETLIKTKEVTDRN HHHHHHHHHCCCCCC | 25.99 | 17693683 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DJC28_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DJC28_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DJC28_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LRC46_HUMAN | LRRC46 | physical | 26186194 | |
ATPB_HUMAN | ATP5B | physical | 28514442 | |
LRC46_HUMAN | LRRC46 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteome profiling of Wnt3a-mediated signalingnetwork: indicating the involvement of ribonucleoside-diphosphatereductase M2 subunit phosphorylation at residue serine 20 in canonicalWnt signal transduction."; Tang L.-Y., Deng N., Wang L.-S., Dai J., Wang Z.-L., Jiang X.-S.,Li S.-J., Li L., Sheng Q.-H., Wu D.-Q., Li L., Zeng R.; Mol. Cell. Proteomics 6:1952-1967(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-347, AND MASSSPECTROMETRY. |