| UniProt ID | DHI2_HUMAN | |
|---|---|---|
| UniProt AC | P80365 | |
| Protein Name | Corticosteroid 11-beta-dehydrogenase isozyme 2 | |
| Gene Name | HSD11B2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 405 | |
| Subcellular Localization | Microsome . Endoplasmic reticulum . | |
| Protein Description | Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.. | |
| Protein Sequence | MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 70 | Phosphorylation | AAGWIALSRLARPQR HHHHHHHHHHCCCCC | 19.07 | 24719451 | |
| 104 | Phosphorylation | ETAKKLDSMGFTVLA HHHHHHHHCCCEEEE | 31.10 | 22210691 | |
| 112 | Phosphorylation | MGFTVLATVLELNSP CCCEEEEEEEHHCCC | 22.82 | 22210691 | |
| 118 | Phosphorylation | ATVLELNSPGAIELR EEEEHHCCCCCEEEE | 37.02 | - | |
| 126 | Phosphorylation | PGAIELRTCCSPRLR CCCEEEECCCCCCHH | 30.41 | 22210691 | |
| 129 | Phosphorylation | IELRTCCSPRLRLLQ EEEECCCCCCHHHCC | 18.40 | 22210691 | |
| 146 | Phosphorylation | LTKPGDISRVLEFTK CCCCCCHHHHHHHHH | 22.52 | 28857561 | |
| 295 | Phosphorylation | PQELLQAYGKDYIEH CHHHHHHHCHHHHHH | 16.26 | 22817900 | |
| 383 | Phosphorylation | LQPGQPGTTPPQDAA CCCCCCCCCCCHHHC | 42.69 | 28857561 | |
| 384 | Phosphorylation | QPGQPGTTPPQDAAQ CCCCCCCCCCHHHCC | 38.60 | 28857561 | |
| 396 | Phosphorylation | AAQDPNLSPGPSPAV HCCCCCCCCCCCCCC | 34.16 | 26657352 | |
| 400 | Phosphorylation | PNLSPGPSPAVAR-- CCCCCCCCCCCCC-- | 31.26 | 28857561 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DHI2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DHI2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DHI2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CTBP1_HUMAN | CTBP1 | physical | 12878208 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 218030 | Apparent mineralocorticoid excess (AME) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
