dbPTM

DHAS_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DHAS_SCHPO
UniProt AC	P78780
Protein Name	Probable aspartate-semialdehyde dehydrogenase
Gene Name	SPCC1827.06c
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	357
Subcellular Localization
Protein Description	Catalyzes the NADPH-dependent formation of L-aspartate-semialdehyde (L-ASA) by the reductive dephosphorylation of L-aspartyl-4-phosphate..
Protein Sequence	MAIKKVGILGATGTVGQRFITLLSDHPEFKIAVLGASARSAGKPYAVATKWKQSIAMPKEISQMSVKACDPKEFSECDIVFSGLDADFAGEIEKSFRDANLVIVSNAKNYRREPTVPLVVPTVNTDHLDVIKYQRQENKLDRGCIITNSNCSTAAVVVPLKALQDAFGPIAQTNVVSMQAISGAGYPGVSSLDILDNIVPFIGGEEEKIEWETRKILGSVNSTISGYELTDNVVSAQCNRVPVIDGHLMCISVKFAKTSPTPDQVREVLANYVSEPQKLGCYSAPKQAIYVFDDSTPDRPQPRLDRNNENGYAVSVGRIRSDSIFDIKFVSLVHNTVLGAAGAGILNAEVAVKKGLM

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	KVGILGATGTVGQRF EEEEECCCCCCHHHH	31.42	25720772
14	Phosphorylation	GILGATGTVGQRFIT EEECCCCCCHHHHHH	19.67	28889911
37	Phosphorylation	KIAVLGASARSAGKP EEEEEHHCHHHCCCC	23.55	28889911
321	Phosphorylation	VSVGRIRSDSIFDIK EEEEEECCCCCEEEE	33.08	25720772
323	Phosphorylation	VGRIRSDSIFDIKFV EEEECCCCCEEEEEE	26.80	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DHAS_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DHAS_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DHAS_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
GST1_SCHPO	gst1	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DHAS_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-323, AND MASSSPECTROMETRY.	18257517 [Abstract]