UniProt ID | DHAS_SCHPO | |
---|---|---|
UniProt AC | P78780 | |
Protein Name | Probable aspartate-semialdehyde dehydrogenase | |
Gene Name | SPCC1827.06c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 357 | |
Subcellular Localization | ||
Protein Description | Catalyzes the NADPH-dependent formation of L-aspartate-semialdehyde (L-ASA) by the reductive dephosphorylation of L-aspartyl-4-phosphate.. | |
Protein Sequence | MAIKKVGILGATGTVGQRFITLLSDHPEFKIAVLGASARSAGKPYAVATKWKQSIAMPKEISQMSVKACDPKEFSECDIVFSGLDADFAGEIEKSFRDANLVIVSNAKNYRREPTVPLVVPTVNTDHLDVIKYQRQENKLDRGCIITNSNCSTAAVVVPLKALQDAFGPIAQTNVVSMQAISGAGYPGVSSLDILDNIVPFIGGEEEKIEWETRKILGSVNSTISGYELTDNVVSAQCNRVPVIDGHLMCISVKFAKTSPTPDQVREVLANYVSEPQKLGCYSAPKQAIYVFDDSTPDRPQPRLDRNNENGYAVSVGRIRSDSIFDIKFVSLVHNTVLGAAGAGILNAEVAVKKGLM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | KVGILGATGTVGQRF EEEEECCCCCCHHHH | 31.42 | 25720772 | |
14 | Phosphorylation | GILGATGTVGQRFIT EEECCCCCCHHHHHH | 19.67 | 28889911 | |
37 | Phosphorylation | KIAVLGASARSAGKP EEEEEHHCHHHCCCC | 23.55 | 28889911 | |
321 | Phosphorylation | VSVGRIRSDSIFDIK EEEEEECCCCCEEEE | 33.08 | 25720772 | |
323 | Phosphorylation | VGRIRSDSIFDIKFV EEEECCCCCEEEEEE | 26.80 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DHAS_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DHAS_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DHAS_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GST1_SCHPO | gst1 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...