DFB4A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DFB4A_HUMAN
• UniProt AC: O15263
• Protein Name: Beta-defensin 4A
• Gene Name: DEFB4A
• Organism: Homo sapiens (Human).
• Sequence Length: 64
• Subcellular Localization: Secreted.
• Protein Description: Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells. [PubMed: 20068036]
• Protein Sequence: MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
47	Phosphorylation	PVFCPRRYKQIGTCG CEECCCCCCEECCCC	14.44	26657352
52	Phosphorylation	RRYKQIGTCGLPGTK CCCCEECCCCCCCCC	12.67	26657352

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DFB4A_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DFB4A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DFB4A_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DFB4A_HUMAN	DEFB4A	physical	10906336
FACE1_HUMAN	ZMPSTE24	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.